commit 2fe8ce91501d45c079c4e84aaddacfafb4868de8 Author: 黄 杰 Date: Thu Jun 5 10:51:52 2025 +0800 1 diff --git a/.gitattributes b/.gitattributes new file mode 100644 index 0000000..1ff0c42 --- /dev/null +++ b/.gitattributes @@ -0,0 +1,63 @@ +############################################################################### +# Set default behavior to automatically normalize line endings. +############################################################################### +* text=auto + +############################################################################### +# Set default behavior for command prompt diff. +# +# This is need for earlier builds of msysgit that does not have it on by +# default for csharp files. +# Note: This is only used by command line +############################################################################### +#*.cs diff=csharp + +############################################################################### +# Set the merge driver for project and solution files +# +# Merging from the command prompt will add diff markers to the files if there +# are conflicts (Merging from VS is not affected by the settings below, in VS +# the diff markers are never inserted). Diff markers may cause the following +# file extensions to fail to load in VS. An alternative would be to treat +# these files as binary and thus will always conflict and require user +# intervention with every merge. To do so, just uncomment the entries below +############################################################################### +#*.sln merge=binary +#*.csproj merge=binary +#*.vbproj merge=binary +#*.vcxproj merge=binary +#*.vcproj merge=binary +#*.dbproj merge=binary +#*.fsproj merge=binary +#*.lsproj merge=binary +#*.wixproj merge=binary +#*.modelproj merge=binary +#*.sqlproj merge=binary +#*.wwaproj merge=binary + +############################################################################### +# behavior for image files +# +# image files are treated as binary by default. +############################################################################### +#*.jpg binary +#*.png binary +#*.gif binary + +############################################################################### +# diff behavior for common document formats +# +# Convert binary document formats to text before diffing them. This feature +# is only available from the command line. Turn it on by uncommenting the +# entries below. +############################################################################### +#*.doc diff=astextplain +#*.DOC diff=astextplain +#*.docx diff=astextplain +#*.DOCX diff=astextplain +#*.dot diff=astextplain +#*.DOT diff=astextplain +#*.pdf diff=astextplain +#*.PDF diff=astextplain +#*.rtf diff=astextplain +#*.RTF diff=astextplain diff --git a/.gitignore b/.gitignore new file mode 100644 index 0000000..9491a2f --- /dev/null +++ b/.gitignore @@ -0,0 +1,363 @@ +## Ignore Visual Studio temporary files, build results, and +## files generated by popular Visual Studio add-ons. +## +## Get latest from https://github.com/github/gitignore/blob/master/VisualStudio.gitignore + +# User-specific files +*.rsuser +*.suo +*.user +*.userosscache +*.sln.docstates + +# User-specific files (MonoDevelop/Xamarin Studio) +*.userprefs + +# Mono auto generated files +mono_crash.* + +# Build results +[Dd]ebug/ +[Dd]ebugPublic/ +[Rr]elease/ +[Rr]eleases/ +x64/ +x86/ +[Ww][Ii][Nn]32/ +[Aa][Rr][Mm]/ +[Aa][Rr][Mm]64/ +bld/ +[Bb]in/ +[Oo]bj/ +[Oo]ut/ +[Ll]og/ +[Ll]ogs/ + +# Visual Studio 2015/2017 cache/options directory +.vs/ +# Uncomment if you have tasks that create the project's static files in wwwroot +#wwwroot/ + +# Visual Studio 2017 auto generated files +Generated\ Files/ + +# MSTest test Results +[Tt]est[Rr]esult*/ +[Bb]uild[Ll]og.* + +# NUnit +*.VisualState.xml +TestResult.xml +nunit-*.xml + +# Build Results of an ATL Project +[Dd]ebugPS/ +[Rr]eleasePS/ +dlldata.c + +# Benchmark Results +BenchmarkDotNet.Artifacts/ + +# .NET Core +project.lock.json +project.fragment.lock.json +artifacts/ + +# ASP.NET Scaffolding +ScaffoldingReadMe.txt + +# StyleCop +StyleCopReport.xml + +# Files built by Visual Studio +*_i.c +*_p.c +*_h.h +*.ilk +*.meta +*.obj +*.iobj +*.pch +*.pdb +*.ipdb +*.pgc +*.pgd +*.rsp +*.sbr +*.tlb +*.tli +*.tlh +*.tmp +*.tmp_proj +*_wpftmp.csproj +*.log +*.vspscc +*.vssscc +.builds +*.pidb +*.svclog +*.scc + +# Chutzpah Test files +_Chutzpah* + +# Visual C++ cache files +ipch/ +*.aps +*.ncb +*.opendb +*.opensdf +*.sdf +*.cachefile +*.VC.db +*.VC.VC.opendb + +# Visual Studio profiler +*.psess +*.vsp +*.vspx +*.sap + +# Visual Studio Trace Files +*.e2e + +# TFS 2012 Local Workspace +$tf/ + +# Guidance Automation Toolkit +*.gpState + +# ReSharper is a .NET coding add-in +_ReSharper*/ +*.[Rr]e[Ss]harper +*.DotSettings.user + +# TeamCity is a build add-in +_TeamCity* + +# DotCover is a Code Coverage Tool +*.dotCover + +# AxoCover is a Code Coverage Tool +.axoCover/* +!.axoCover/settings.json + +# Coverlet is a free, cross platform Code Coverage Tool +coverage*.json +coverage*.xml +coverage*.info + +# Visual Studio code coverage results +*.coverage +*.coveragexml + +# NCrunch +_NCrunch_* +.*crunch*.local.xml +nCrunchTemp_* + +# MightyMoose +*.mm.* +AutoTest.Net/ + +# Web workbench (sass) +.sass-cache/ + +# Installshield output folder +[Ee]xpress/ + +# DocProject is a documentation generator add-in +DocProject/buildhelp/ +DocProject/Help/*.HxT +DocProject/Help/*.HxC +DocProject/Help/*.hhc +DocProject/Help/*.hhk +DocProject/Help/*.hhp +DocProject/Help/Html2 +DocProject/Help/html + +# Click-Once directory +publish/ + +# Publish Web Output +*.[Pp]ublish.xml +*.azurePubxml +# Note: Comment the next line if you want to checkin your web deploy settings, +# but database connection strings (with potential passwords) will be unencrypted +*.pubxml +*.publishproj + +# Microsoft Azure Web App publish settings. Comment the next line if you want to +# checkin your Azure Web App publish settings, but sensitive information contained +# in these scripts will be unencrypted +PublishScripts/ + +# NuGet Packages +*.nupkg +# NuGet Symbol Packages +*.snupkg +# The packages folder can be ignored because of Package Restore +**/[Pp]ackages/* +# except build/, which is used as an MSBuild target. +!**/[Pp]ackages/build/ +# Uncomment if necessary however generally it will be regenerated when needed +#!**/[Pp]ackages/repositories.config +# NuGet v3's project.json files produces more ignorable files +*.nuget.props +*.nuget.targets + +# Microsoft Azure Build Output +csx/ +*.build.csdef + +# Microsoft Azure Emulator +ecf/ +rcf/ + +# Windows Store app package directories and files +AppPackages/ +BundleArtifacts/ +Package.StoreAssociation.xml +_pkginfo.txt +*.appx +*.appxbundle +*.appxupload + +# Visual Studio cache files +# files ending in .cache can be ignored +*.[Cc]ache +# but keep track of directories ending in .cache +!?*.[Cc]ache/ + +# Others +ClientBin/ +~$* +*~ +*.dbmdl +*.dbproj.schemaview +*.jfm +*.pfx +*.publishsettings +orleans.codegen.cs + +# Including strong name files can present a security risk +# (https://github.com/github/gitignore/pull/2483#issue-259490424) +#*.snk + +# Since there are multiple workflows, uncomment next line to ignore bower_components +# (https://github.com/github/gitignore/pull/1529#issuecomment-104372622) +#bower_components/ + +# RIA/Silverlight projects +Generated_Code/ + +# Backup & report files from converting an old project file +# to a newer Visual Studio version. Backup files are not needed, +# because we have git ;-) +_UpgradeReport_Files/ +Backup*/ +UpgradeLog*.XML +UpgradeLog*.htm +ServiceFabricBackup/ +*.rptproj.bak + +# SQL Server files +*.mdf +*.ldf +*.ndf + +# Business Intelligence projects +*.rdl.data +*.bim.layout +*.bim_*.settings +*.rptproj.rsuser +*- [Bb]ackup.rdl +*- [Bb]ackup ([0-9]).rdl +*- [Bb]ackup ([0-9][0-9]).rdl + +# Microsoft Fakes +FakesAssemblies/ + +# GhostDoc plugin setting file +*.GhostDoc.xml + +# Node.js Tools for Visual Studio +.ntvs_analysis.dat +node_modules/ + +# Visual Studio 6 build log +*.plg + +# Visual Studio 6 workspace options file +*.opt + +# Visual Studio 6 auto-generated workspace file (contains which files were open etc.) +*.vbw + +# Visual Studio LightSwitch build output +**/*.HTMLClient/GeneratedArtifacts +**/*.DesktopClient/GeneratedArtifacts +**/*.DesktopClient/ModelManifest.xml +**/*.Server/GeneratedArtifacts +**/*.Server/ModelManifest.xml +_Pvt_Extensions + +# Paket dependency manager +.paket/paket.exe +paket-files/ + +# FAKE - F# Make +.fake/ + +# CodeRush personal settings +.cr/personal + +# Python Tools for Visual Studio (PTVS) +__pycache__/ +*.pyc + +# Cake - Uncomment if you are using it +# tools/** +# !tools/packages.config + +# Tabs Studio +*.tss + +# Telerik's JustMock configuration file +*.jmconfig + +# BizTalk build output +*.btp.cs +*.btm.cs +*.odx.cs +*.xsd.cs + +# OpenCover UI analysis results +OpenCover/ + +# Azure Stream Analytics local run output +ASALocalRun/ + +# MSBuild Binary and Structured Log +*.binlog + +# NVidia Nsight GPU debugger configuration file +*.nvuser + +# MFractors (Xamarin productivity tool) working folder +.mfractor/ + +# Local History for Visual Studio +.localhistory/ + +# BeatPulse healthcheck temp database +healthchecksdb + +# Backup folder for Package Reference Convert tool in Visual Studio 2017 +MigrationBackup/ + +# Ionide (cross platform F# VS Code tools) working folder +.ionide/ + +# Fody - auto-generated XML schema +FodyWeavers.xsd \ No newline at end of file diff --git a/PdbChecker.sln b/PdbChecker.sln new file mode 100644 index 0000000..6d43e27 --- /dev/null +++ b/PdbChecker.sln @@ -0,0 +1,65 @@ + +Microsoft Visual Studio Solution File, Format Version 12.00 +# Visual Studio Version 17 +VisualStudioVersion = 17.0.32126.317 +MinimumVisualStudioVersion = 10.0.40219.1 +Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "PdbChecker", "PdbChecker\PdbChecker.vcxproj", "{BB78E585-C6E4-4DA5-A622-E4182879747B}" +EndProject +Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "PdbServer", "PdbServer\PdbServer.csproj", "{1AC34856-024B-431F-BC1B-CA4A4F0992D9}" +EndProject +Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "UpLoader", "UpLoader\UpLoader.vcxproj", "{B9E9EF11-138C-467C-8118-F87ED46F35A5}" +EndProject +Global + GlobalSection(SolutionConfigurationPlatforms) = preSolution + Debug|Any CPU = Debug|Any CPU + Debug|x64 = Debug|x64 + Debug|x86 = Debug|x86 + Release|Any CPU = Release|Any CPU + Release|x64 = Release|x64 + Release|x86 = Release|x86 + EndGlobalSection + GlobalSection(ProjectConfigurationPlatforms) = postSolution + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Debug|Any CPU.ActiveCfg = Debug|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Debug|Any CPU.Build.0 = Debug|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Debug|x64.ActiveCfg = Debug|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Debug|x64.Build.0 = Debug|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Debug|x86.ActiveCfg = Debug|Win32 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Debug|x86.Build.0 = Debug|Win32 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Release|Any CPU.ActiveCfg = Release|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Release|Any CPU.Build.0 = Release|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Release|x64.ActiveCfg = Release|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Release|x64.Build.0 = Release|x64 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Release|x86.ActiveCfg = Release|Win32 + {BB78E585-C6E4-4DA5-A622-E4182879747B}.Release|x86.Build.0 = Release|Win32 + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Debug|Any CPU.ActiveCfg = Debug|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Debug|Any CPU.Build.0 = Debug|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Debug|x64.ActiveCfg = Debug|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Debug|x64.Build.0 = Debug|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Debug|x86.ActiveCfg = Debug|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Debug|x86.Build.0 = Debug|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Release|Any CPU.ActiveCfg = Release|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Release|Any CPU.Build.0 = Release|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Release|x64.ActiveCfg = Release|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Release|x64.Build.0 = Release|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Release|x86.ActiveCfg = Release|Any CPU + {1AC34856-024B-431F-BC1B-CA4A4F0992D9}.Release|x86.Build.0 = Release|Any CPU + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Debug|Any CPU.ActiveCfg = Debug|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Debug|Any CPU.Build.0 = Debug|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Debug|x64.ActiveCfg = Debug|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Debug|x64.Build.0 = Debug|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Debug|x86.ActiveCfg = Debug|Win32 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Debug|x86.Build.0 = Debug|Win32 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Release|Any CPU.ActiveCfg = Release|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Release|Any CPU.Build.0 = Release|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Release|x64.ActiveCfg = Release|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Release|x64.Build.0 = Release|x64 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Release|x86.ActiveCfg = Release|Win32 + {B9E9EF11-138C-467C-8118-F87ED46F35A5}.Release|x86.Build.0 = Release|Win32 + EndGlobalSection + GlobalSection(SolutionProperties) = preSolution + HideSolutionNode = FALSE + EndGlobalSection + GlobalSection(ExtensibilityGlobals) = postSolution + SolutionGuid = {B2CACF75-DA70-49F9-95A8-7257E2C4A135} + EndGlobalSection +EndGlobal diff --git a/PdbChecker/Http.hpp b/PdbChecker/Http.hpp new file mode 100644 index 0000000..4c159bf --- /dev/null +++ b/PdbChecker/Http.hpp @@ -0,0 +1,855 @@ +#pragma once +#ifndef HTTPREQUEST_HPP +#define HTTPREQUEST_HPP + +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +#if defined(_WIN32) || defined(__CYGWIN__) +# pragma push_macro("WIN32_LEAN_AND_MEAN") +# pragma push_macro("NOMINMAX") +# ifndef WIN32_LEAN_AND_MEAN +# define WIN32_LEAN_AND_MEAN +# endif // WIN32_LEAN_AND_MEAN +# ifndef NOMINMAX +# define NOMINMAX +# endif // NOMINMAX +# include +# if _WIN32_WINNT < _WIN32_WINNT_WINXP +extern "C" char* _strdup(const char* strSource); +# define strdup _strdup +# include +# endif // _WIN32_WINNT < _WIN32_WINNT_WINXP +# include +# pragma pop_macro("WIN32_LEAN_AND_MEAN") +# pragma pop_macro("NOMINMAX") +#else +# include +# include +# include +# include +# include +# include +# include +# include +#endif // defined(_WIN32) || defined(__CYGWIN__) + +namespace http +{ + class RequestError final : public std::logic_error + { + public: + explicit RequestError(const char* str) : std::logic_error{ str } {} + explicit RequestError(const std::string& str) : std::logic_error{ str } {} + }; + + class ResponseError final : public std::runtime_error + { + public: + explicit ResponseError(const char* str) : std::runtime_error{ str } {} + explicit ResponseError(const std::string& str) : std::runtime_error{ str } {} + }; + + enum class InternetProtocol : std::uint8_t + { + V4, + V6 + }; + + inline namespace detail + { +#if defined(_WIN32) || defined(__CYGWIN__) + class WinSock final + { + public: + WinSock() + { + WSADATA wsaData; + const auto error = WSAStartup(MAKEWORD(2, 2), &wsaData); + if (error != 0) + throw std::system_error{ error, std::system_category(), "WSAStartup failed" }; + + if (LOBYTE(wsaData.wVersion) != 2 || HIBYTE(wsaData.wVersion) != 2) + { + WSACleanup(); + throw std::runtime_error{ "Invalid WinSock version" }; + } + + started = true; + } + + ~WinSock() + { + if (started) WSACleanup(); + } + + WinSock(WinSock&& other) noexcept : + started{ other.started } + { + other.started = false; + } + + WinSock& operator=(WinSock&& other) noexcept + { + if (&other == this) return *this; + if (started) WSACleanup(); + started = other.started; + other.started = false; + return *this; + } + + private: + bool started = false; + }; +#endif // defined(_WIN32) || defined(__CYGWIN__) + + inline int getLastError() noexcept + { +#if defined(_WIN32) || defined(__CYGWIN__) + return WSAGetLastError(); +#else + return errno; +#endif // defined(_WIN32) || defined(__CYGWIN__) + } + + constexpr int getAddressFamily(const InternetProtocol internetProtocol) + { + return (internetProtocol == InternetProtocol::V4) ? AF_INET : + (internetProtocol == InternetProtocol::V6) ? AF_INET6 : + throw RequestError{ "Unsupported protocol" }; + } + + class Socket final + { + public: +#if defined(_WIN32) || defined(__CYGWIN__) + using Type = SOCKET; + static constexpr Type invalid = INVALID_SOCKET; +#else + using Type = int; + static constexpr Type invalid = -1; +#endif // defined(_WIN32) || defined(__CYGWIN__) + + explicit Socket(const InternetProtocol internetProtocol) : + endpoint{ socket(getAddressFamily(internetProtocol), SOCK_STREAM, IPPROTO_TCP) } + { + if (endpoint == invalid) + throw std::system_error{ getLastError(), std::system_category(), "Failed to create socket" }; + +#if defined(_WIN32) || defined(__CYGWIN__) + ULONG mode = 1; + if (ioctlsocket(endpoint, FIONBIO, &mode) != 0) + { + close(); + throw std::system_error{ WSAGetLastError(), std::system_category(), "Failed to get socket flags" }; + } +#else + const auto flags = fcntl(endpoint, F_GETFL); + if (flags == -1) + { + close(); + throw std::system_error{ errno, std::system_category(), "Failed to get socket flags" }; + } + + if (fcntl(endpoint, F_SETFL, flags | O_NONBLOCK) == -1) + { + close(); + throw std::system_error{ errno, std::system_category(), "Failed to set socket flags" }; + } +#endif // defined(_WIN32) || defined(__CYGWIN__) + +#ifdef __APPLE__ + const int value = 1; + if (setsockopt(endpoint, SOL_SOCKET, SO_NOSIGPIPE, &value, sizeof(value)) == -1) + { + close(); + throw std::system_error{ errno, std::system_category(), "Failed to set socket option" }; + } +#endif // __APPLE__ + } + + ~Socket() + { + if (endpoint != invalid) close(); + } + + Socket(Socket&& other) noexcept : + endpoint{ other.endpoint } + { + other.endpoint = invalid; + } + + Socket& operator=(Socket&& other) noexcept + { + if (&other == this) return *this; + if (endpoint != invalid) close(); + endpoint = other.endpoint; + other.endpoint = invalid; + return *this; + } + + void connect(const struct sockaddr* address, const socklen_t addressSize, const std::int64_t timeout) + { +#if defined(_WIN32) || defined(__CYGWIN__) + auto result = ::connect(endpoint, address, addressSize); + while (result == -1 && WSAGetLastError() == WSAEINTR) + result = ::connect(endpoint, address, addressSize); + + if (result == -1) + { + if (WSAGetLastError() == WSAEWOULDBLOCK) + { + select(SelectType::write, timeout); + + char socketErrorPointer[sizeof(int)]; + socklen_t optionLength = sizeof(socketErrorPointer); + if (getsockopt(endpoint, SOL_SOCKET, SO_ERROR, socketErrorPointer, &optionLength) == -1) + throw std::system_error{ WSAGetLastError(), std::system_category(), "Failed to get socket option" }; + + int socketError; + std::memcpy(&socketError, socketErrorPointer, sizeof(socketErrorPointer)); + + if (socketError != 0) + throw std::system_error{ socketError, std::system_category(), "Failed to connect" }; + } + else + throw std::system_error{ WSAGetLastError(), std::system_category(), "Failed to connect" }; + } +#else + auto result = ::connect(endpoint, address, addressSize); + while (result == -1 && errno == EINTR) + result = ::connect(endpoint, address, addressSize); + + if (result == -1) + { + if (errno == EINPROGRESS) + { + select(SelectType::write, timeout); + + int socketError; + socklen_t optionLength = sizeof(socketError); + if (getsockopt(endpoint, SOL_SOCKET, SO_ERROR, &socketError, &optionLength) == -1) + throw std::system_error{ errno, std::system_category(), "Failed to get socket option" }; + + if (socketError != 0) + throw std::system_error{ socketError, std::system_category(), "Failed to connect" }; + } + else + throw std::system_error{ errno, std::system_category(), "Failed to connect" }; + } +#endif // defined(_WIN32) || defined(__CYGWIN__) + } + + std::size_t send(const void* buffer, const std::size_t length, const std::int64_t timeout) + { + select(SelectType::write, timeout); +#if defined(_WIN32) || defined(__CYGWIN__) + auto result = ::send(endpoint, reinterpret_cast(buffer), + static_cast(length), 0); + + while (result == -1 && WSAGetLastError() == WSAEINTR) + result = ::send(endpoint, reinterpret_cast(buffer), + static_cast(length), 0); + + if (result == -1) + throw std::system_error{ WSAGetLastError(), std::system_category(), "Failed to send data" }; +#else + auto result = ::send(endpoint, reinterpret_cast(buffer), + length, noSignal); + + while (result == -1 && errno == EINTR) + result = ::send(endpoint, reinterpret_cast(buffer), + length, noSignal); + + if (result == -1) + throw std::system_error{ errno, std::system_category(), "Failed to send data" }; +#endif // defined(_WIN32) || defined(__CYGWIN__) + return static_cast(result); + } + + std::size_t recv(void* buffer, const std::size_t length, const std::int64_t timeout) + { + select(SelectType::read, timeout); +#if defined(_WIN32) || defined(__CYGWIN__) + auto result = ::recv(endpoint, reinterpret_cast(buffer), + static_cast(length), 0); + + while (result == -1 && WSAGetLastError() == WSAEINTR) + result = ::recv(endpoint, reinterpret_cast(buffer), + static_cast(length), 0); + + if (result == -1) + throw std::system_error{ WSAGetLastError(), std::system_category(), "Failed to read data" }; +#else + auto result = ::recv(endpoint, reinterpret_cast(buffer), + length, noSignal); + + while (result == -1 && errno == EINTR) + result = ::recv(endpoint, reinterpret_cast(buffer), + length, noSignal); + + if (result == -1) + throw std::system_error{ errno, std::system_category(), "Failed to read data" }; +#endif // defined(_WIN32) || defined(__CYGWIN__) + return static_cast(result); + } + + private: + enum class SelectType + { + read, + write + }; + + void select(const SelectType type, const std::int64_t timeout) + { + fd_set descriptorSet; + FD_ZERO(&descriptorSet); + FD_SET(endpoint, &descriptorSet); + +#if defined(_WIN32) || defined(__CYGWIN__) + TIMEVAL selectTimeout{ + static_cast(timeout / 1000), + static_cast((timeout % 1000) * 1000) + }; + auto count = ::select(0, + (type == SelectType::read) ? &descriptorSet : nullptr, + (type == SelectType::write) ? &descriptorSet : nullptr, + nullptr, + (timeout >= 0) ? &selectTimeout : nullptr); + + while (count == -1 && WSAGetLastError() == WSAEINTR) + count = ::select(0, + (type == SelectType::read) ? &descriptorSet : nullptr, + (type == SelectType::write) ? &descriptorSet : nullptr, + nullptr, + (timeout >= 0) ? &selectTimeout : nullptr); + + if (count == -1) + throw std::system_error{ WSAGetLastError(), std::system_category(), "Failed to select socket" }; + else if (count == 0) + throw ResponseError{ "Request timed out" }; +#else + timeval selectTimeout{ + static_cast(timeout / 1000), + static_cast((timeout % 1000) * 1000) + }; + auto count = ::select(endpoint + 1, + (type == SelectType::read) ? &descriptorSet : nullptr, + (type == SelectType::write) ? &descriptorSet : nullptr, + nullptr, + (timeout >= 0) ? &selectTimeout : nullptr); + + while (count == -1 && errno == EINTR) + count = ::select(endpoint + 1, + (type == SelectType::read) ? &descriptorSet : nullptr, + (type == SelectType::write) ? &descriptorSet : nullptr, + nullptr, + (timeout >= 0) ? &selectTimeout : nullptr); + + if (count == -1) + throw std::system_error{ errno, std::system_category(), "Failed to select socket" }; + else if (count == 0) + throw ResponseError{ "Request timed out" }; +#endif // defined(_WIN32) || defined(__CYGWIN__) + } + + void close() noexcept + { +#if defined(_WIN32) || defined(__CYGWIN__) + closesocket(endpoint); +#else + ::close(endpoint); +#endif // defined(_WIN32) || defined(__CYGWIN__) + } + +#if defined(__unix__) && !defined(__APPLE__) && !defined(__CYGWIN__) + static constexpr int noSignal = MSG_NOSIGNAL; +#else + static constexpr int noSignal = 0; +#endif // defined(__unix__) && !defined(__APPLE__) + + Type endpoint = invalid; + }; + + inline bool isWhitespaceChar(const char c) noexcept + { + // RFC 7230, 3.2.3. Whitespace + return c == ' ' || c == '\t'; + }; + + inline bool isDigitChar(const char c) noexcept + { + // RFC 5234, Appendix B.1. Core Rules + return c >= '0' && c <= '9'; + } + + inline bool isAlphaChar(const char c) noexcept + { + // RFC 5234, Appendix B.1. Core Rules + return (c >= 'a' && c <= 'z') || (c >= 'A' && c <= 'Z'); + } + + inline bool isTokenChar(const char c) noexcept + { + // RFC 7230, 3.2.6. Field Value Components + return c == '!' || c == '#' || c == '$' || c == '%' || c == '&' || c == '\'' || c == '*' || + c == '+' || c == '-' || c == '.' || c == '^' || c == '_' || c == '`' || c == '|' || c == '~' || + isDigitChar(c) || + isAlphaChar(c); + }; + + // RFC 5234, B.1. Core Rules + inline bool isVisibleChar(const char c) noexcept + { + return c >= 0x21 && c <= 0x7E; + } + + // RFC 7230, Appendix B. Collected ABNF + inline bool isObsTextChar(const char c) noexcept + { + return static_cast(c) >= 0x80 && + static_cast(c) <= 0xFF; + } + + template + Iterator skipWhitespaces(const Iterator begin, const Iterator end) + { + auto i = begin; + for (i = begin; i != end; ++i) + if (!isWhitespaceChar(*i)) + break; + + return i; + } + + // RFC 7230, 3.2.6. Field Value Components + template + std::pair parseToken(const Iterator begin, const Iterator end) + { + std::string result; + + auto i = begin; + for (; i != end && isTokenChar(*i); ++i) + result.push_back(*i); + + if (result.empty()) + throw ResponseError{ "Invalid token" }; + + return std::make_pair(i, std::move(result)); + } + + template + std::pair parseFieldValue(const Iterator begin, const Iterator end) + { + std::string result; + + auto i = begin; + for (; i != end && (isVisibleChar(*i) || isWhitespaceChar(*i) || isObsTextChar(*i)); ++i) + result.push_back(*i); + + return std::make_pair(i, std::move(result)); + } + } + + struct Response final + { + // RFC 7231, 6. Response Status Codes + enum Status + { + Continue = 100, + SwitchingProtocol = 101, + Processing = 102, + EarlyHints = 103, + + Ok = 200, + Created = 201, + Accepted = 202, + NonAuthoritativeInformation = 203, + NoContent = 204, + ResetContent = 205, + PartialContent = 206, + MultiStatus = 207, + AlreadyReported = 208, + ImUsed = 226, + + MultipleChoice = 300, + MovedPermanently = 301, + Found = 302, + SeeOther = 303, + NotModified = 304, + UseProxy = 305, + TemporaryRedirect = 307, + PermanentRedirect = 308, + + BadRequest = 400, + Unauthorized = 401, + PaymentRequired = 402, + Forbidden = 403, + NotFound = 404, + MethodNotAllowed = 405, + NotAcceptable = 406, + ProxyAuthenticationRequired = 407, + RequestTimeout = 408, + Conflict = 409, + Gone = 410, + LengthRequired = 411, + PreconditionFailed = 412, + PayloadTooLarge = 413, + UriTooLong = 414, + UnsupportedMediaType = 415, + RangeNotSatisfiable = 416, + ExpectationFailed = 417, + MisdirectedRequest = 421, + UnprocessableEntity = 422, + Locked = 423, + FailedDependency = 424, + TooEarly = 425, + UpgradeRequired = 426, + PreconditionRequired = 428, + TooManyRequests = 429, + RequestHeaderFieldsTooLarge = 431, + UnavailableForLegalReasons = 451, + + InternalServerError = 500, + NotImplemented = 501, + BadGateway = 502, + ServiceUnavailable = 503, + GatewayTimeout = 504, + HttpVersionNotSupported = 505, + VariantAlsoNegotiates = 506, + InsufficientStorage = 507, + LoopDetected = 508, + NotExtended = 510, + NetworkAuthenticationRequired = 511 + }; + + int status = 0; + std::string description; + std::vector headers; + std::vector body; + }; + + class Request final + { + public: + explicit Request(const std::string& url, + const InternetProtocol protocol = InternetProtocol::V4) : + internetProtocol{ protocol } + { + const auto schemeEndPosition = url.find("://"); + + if (schemeEndPosition != std::string::npos) + { + scheme = url.substr(0, schemeEndPosition); + path = url.substr(schemeEndPosition + 3); + } + else + { + scheme = "http"; + path = url; + } + + const auto fragmentPosition = path.find('#'); + + // remove the fragment part + if (fragmentPosition != std::string::npos) + path.resize(fragmentPosition); + + const auto pathPosition = path.find('/'); + + if (pathPosition == std::string::npos) + { + host = path; + path = "/"; + } + else + { + host = path.substr(0, pathPosition); + path = path.substr(pathPosition); + } + + const auto portPosition = host.find(':'); + + if (portPosition != std::string::npos) + { + domain = host.substr(0, portPosition); + port = host.substr(portPosition + 1); + } + else + { + domain = host; + port = "80"; + } + } + + Response send(const std::string& method = "GET", + const std::string& body = "", + const std::vector& headers = {}, + const std::chrono::milliseconds timeout = std::chrono::milliseconds{ -1 }) + { + return send(method, + std::vector(body.begin(), body.end()), + headers, + timeout); + } + + Response send(const std::string& method, + const std::vector& body, + const std::vector& headers, + const std::chrono::milliseconds timeout = std::chrono::milliseconds{ -1 }) + { + const auto stopTime = std::chrono::steady_clock::now() + timeout; + + if (scheme != "http") + throw RequestError{ "Only HTTP scheme is supported" }; + + addrinfo hints = {}; + hints.ai_family = getAddressFamily(internetProtocol); + hints.ai_socktype = SOCK_STREAM; + + addrinfo* info; + if (getaddrinfo(domain.c_str(), port.c_str(), &hints, &info) != 0) + throw std::system_error{ getLastError(), std::system_category(), "Failed to get address info of " + domain }; + + const std::unique_ptr addressInfo{ info, freeaddrinfo }; + + // RFC 7230, 3.1.1. Request Line + std::string headerData = method + " " + path + " HTTP/1.1\r\n"; + + for (const auto& header : headers) + headerData += header + "\r\n"; + + // RFC 7230, 3.2. Header Fields + headerData += "Host: " + host + "\r\n" + "Content-Length: " + std::to_string(body.size()) + "\r\n" + "\r\n"; + + std::vector requestData(headerData.begin(), headerData.end()); + requestData.insert(requestData.end(), body.begin(), body.end()); + + Socket socket{ internetProtocol }; + + const auto getRemainingMilliseconds = [](const std::chrono::steady_clock::time_point time) noexcept -> std::int64_t { + const auto now = std::chrono::steady_clock::now(); + const auto remainingTime = std::chrono::duration_cast(time - now); + return (remainingTime.count() > 0) ? remainingTime.count() : 0; + }; + + // take the first address from the list + socket.connect(addressInfo->ai_addr, static_cast(addressInfo->ai_addrlen), + (timeout.count() >= 0) ? getRemainingMilliseconds(stopTime) : -1); + + auto remaining = requestData.size(); + auto sendData = requestData.data(); + + // send the request + while (remaining > 0) + { + const auto size = socket.send(sendData, remaining, + (timeout.count() >= 0) ? getRemainingMilliseconds(stopTime) : -1); + remaining -= size; + sendData += size; + } + + std::array tempBuffer; + constexpr std::array crlf = { '\r', '\n' }; + Response response; + std::vector responseData; + enum class State + { + parsingStatusLine, + parsingHeaders, + parsingBody + } state = State::parsingStatusLine; + bool contentLengthReceived = false; + std::size_t contentLength = 0; + bool chunkedResponse = false; + std::size_t expectedChunkSize = 0; + bool removeCrlfAfterChunk = false; + + // read the response + for (;;) + { + const auto size = socket.recv(tempBuffer.data(), tempBuffer.size(), + (timeout.count() >= 0) ? getRemainingMilliseconds(stopTime) : -1); + if (size == 0) // disconnected + return response; + + responseData.insert(responseData.end(), tempBuffer.begin(), tempBuffer.begin() + size); + + if (state != State::parsingBody) + for (;;) + { + // RFC 7230, 3. Message Format + const auto i = std::search(responseData.begin(), responseData.end(), crlf.begin(), crlf.end()); + + // didn't find a newline + if (i == responseData.end()) break; + + const std::string line(responseData.begin(), i); + responseData.erase(responseData.begin(), i + 2); + + // empty line indicates the end of the header section (RFC 7230, 2.1. Client/Server Messaging) + if (line.empty()) + { + state = State::parsingBody; + break; + } + else if (state == State::parsingStatusLine) // RFC 7230, 3.1.2. Status Line + { + state = State::parsingHeaders; + + const auto httpEndIterator = std::find(line.begin(), line.end(), ' '); + + if (httpEndIterator != line.end()) + { + const auto statusStartIterator = httpEndIterator + 1; + const auto statusEndIterator = std::find(statusStartIterator, line.end(), ' '); + const std::string status{ statusStartIterator, statusEndIterator }; + response.status = std::stoi(status); + + if (statusEndIterator != line.end()) + { + const auto descriptionStartIterator = statusEndIterator + 1; + response.description = std::string{ descriptionStartIterator, line.end() }; + } + } + } + else if (state == State::parsingHeaders) // RFC 7230, 3.2. Header Fields + { + response.headers.push_back(line); + + auto headerIterator = line.cbegin(); + const auto tokenResult = parseToken(headerIterator, line.cend()); + headerIterator = tokenResult.first; + auto headerName = std::move(tokenResult.second); + + const auto toLower = [](const char c) noexcept { + return (c >= 'A' && c <= 'Z') ? c - ('A' - 'a') : c; + }; + + std::transform(headerName.begin(), headerName.end(), headerName.begin(), toLower); + + if (headerIterator == line.cend()) + throw ResponseError{ "Invalid header" }; + + if (*headerIterator++ != ':') + throw ResponseError{ "Invalid header" }; + + headerIterator = skipWhitespaces(headerIterator, line.cend()); + + const auto valueResult = parseFieldValue(headerIterator, line.cend()); + + headerIterator = valueResult.first; + auto headerValue = std::move(valueResult.second); + + headerIterator = skipWhitespaces(headerIterator, line.cend()); + + if (headerIterator != line.cend()) + throw ResponseError{ "Invalid header" }; + + if (headerName == "content-length") + { + contentLength = std::stoul(headerValue); + contentLengthReceived = true; + response.body.reserve(contentLength); + } + else if (headerName == "transfer-encoding") + { + if (headerValue == "chunked") + chunkedResponse = true; + else + throw ResponseError{ "Unsupported transfer encoding: " + headerValue }; + } + } + } + + if (state == State::parsingBody) + { + // Content-Length must be ignored if Transfer-Encoding is received (RFC 7230, 3.2. Content-Length) + if (chunkedResponse) + { + for (;;) + { + if (expectedChunkSize > 0) + { + const auto toWrite = (std::min)(expectedChunkSize, responseData.size()); + response.body.insert(response.body.end(), responseData.begin(), + responseData.begin() + static_cast(toWrite)); + responseData.erase(responseData.begin(), + responseData.begin() + static_cast(toWrite)); + expectedChunkSize -= toWrite; + + if (expectedChunkSize == 0) removeCrlfAfterChunk = true; + if (responseData.empty()) break; + } + else + { + if (removeCrlfAfterChunk) + { + if (responseData.size() < 2) break; + + if (!std::equal(crlf.begin(), crlf.end(), responseData.begin())) + throw ResponseError{ "Invalid chunk" }; + + removeCrlfAfterChunk = false; + responseData.erase(responseData.begin(), responseData.begin() + 2); + } + + const auto i = std::search(responseData.begin(), responseData.end(), + crlf.begin(), crlf.end()); + + if (i == responseData.end()) break; + + const std::string line(responseData.begin(), i); + responseData.erase(responseData.begin(), i + 2); + + expectedChunkSize = std::stoul(line, nullptr, 16); + if (expectedChunkSize == 0) + return response; + } + } + } + else + { + response.body.insert(response.body.end(), responseData.begin(), responseData.end()); + responseData.clear(); + + // got the whole content + if (contentLengthReceived && response.body.size() >= contentLength) + return response; + } + } + } + + return response; + } + + private: +#if defined(_WIN32) || defined(__CYGWIN__) + WinSock winSock; +#endif // defined(_WIN32) || defined(__CYGWIN__) + InternetProtocol internetProtocol; + std::string scheme; + std::string host; + std::string domain; + std::string port; + std::string path; + }; +} + +#endif // HTTPREQUEST_HPP diff --git a/PdbChecker/NET2.lib b/PdbChecker/NET2.lib new file mode 100644 index 0000000..8017fb5 Binary files /dev/null and b/PdbChecker/NET2.lib differ diff --git a/PdbChecker/Native/List.h b/PdbChecker/Native/List.h new file mode 100644 index 0000000..1593d64 --- /dev/null +++ b/PdbChecker/Native/List.h @@ -0,0 +1,240 @@ +#pragma once +#include +#include +using namespace std; +#define _defaultCapacity 4 +namespace System +{ + namespace Collections + { + namespace Generic + { +#ifndef PROPERTY +#define PROPERTY(t,n) __declspec( property (put = property__set_##n, get = property__get_##n)) t n +#define READONLY_PROPERTY(t,n) __declspec( property (get = property__get_##n) ) t n +#define WRITEONLY_PROPERTY(t,n) __declspec( property (put = property__set_##n) ) t n +#define GET(t,n) t property__get_##n() +#define SET(t,n) void property__set_##n(const t& value) +#endif // !PROPERTY + template> + class List :public vector + { + public: + List() {} + List(T* val, int len) + { + for (int i = 0; i < len; i++) + { + this->push_back(val[i]); + } + } + List(initializer_list val) + { + for (int i = 0; i < val.size(); i++) + { + this->push_back(val.begin()[i]); + } + } + List(vector< T> val) + { + for (int i = 0; i < val.size(); i++) + { + this->push_back(val[i]); + } + } + ~List() {} + T& operator[](int index) + { + return this->data()[index]; + } + PROPERTY(int, Count); + GET(int, Count) + { + return this->size(); + } + SET(int, Count) + { + this->resize(value); + } + void Add(T val) + { + this->push_back(val); + } + void Clear() + { + this->clear(); + } + void AddRange(T* val, int len) + { + int ldx = this->Count; + this->resize(this->size() + len); + memcpy(&this->operator[](ldx), &val[0], sizeof(T) * len); + } + void AddRange(initializer_list& val) + { + int ldx = this->Count; + this->resize(this->size() + val.size()); + memcpy(&this->data()[ldx], &val.begin()[0], sizeof(T) * val.size()); + } + void AddRange(List& val) + { + int ldx = this->Count; + this->resize(this->size() + val.size()); + memcpy(&this->data()[ldx], &val[0], sizeof(T) * val.size()); + } + void AddRange(List* val) + { + int ldx = this->Count; + this->resize(this->size() + val->size()); + memcpy(&this->data()[ldx], &val->data()[0], sizeof(T) * val->size()); + } + void AddRange(vector& val) + { + int ldx = this->Count; + this->resize(this->size() + val.size()); + memcpy(&this->data()[ldx], &val[0], sizeof(T) * val.size()); + } + void AddRange(vector* val) + { + int ldx = this->Count; + this->resize(this->size() + val->size()); + memcpy(&this->data()[ldx], &val->data()[0], sizeof(T) * val->size()); + } + + void Insert(int index, T val) + { + if (index >= this->size()) + { + this->push_back(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val); + } + } + void Insert(int index, initializer_list& val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val.begin(), val.end() - 1); + } + } + void Insert(int index, vector& val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val.begin(), val.end() - 1); + } + } + void Insert(int index, vector* val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val->begin(), val->end() - 1); + } + } + void Insert(int index, List& val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val.begin(), val.end() - 1); + } + } + void Insert(int index, List* val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val->begin(), val->end() - 1); + } + } + void RemoveAt(int index) + { + if (index >= 0 && index < this->size()) + { + this->erase(this->begin() + index); + } + } + int IndexOf(T& value) + { + for (int i = 0; i < this->Count; i++) + { + if (this->at(i) == value) + { + return i; + } + } + return -1; + } + bool Contains(T& value) + { + return IndexOf(value) >= 0; + } + int LastIndexOf(T& value) + { + for (int i = this->Count - 1; i >= 0; i--) + { + if (this->at(i) == value) + { + return i; + } + } + return -1; + } + bool Remove(T& item) + { + int num = IndexOf(item); + if (num >= 0) + { + RemoveAt(num); + return true; + } + return false; + } + vector& GetVector() + { + return *(vector*)this; + } + T* Pointer() + { + return this->data(); + } + T& get(int i) + { + return this->data()[i]; + } + void set(int i, T val) + { + this->data()[i] = val; + } + T& First() + { + return this->data()[0]; + } + T& Last() + { + return this->data()[this->size() - 1]; + } + }; + } + } +} \ No newline at end of file diff --git a/PdbChecker/Native/Native.h b/PdbChecker/Native/Native.h new file mode 100644 index 0000000..18dfb13 --- /dev/null +++ b/PdbChecker/Native/Native.h @@ -0,0 +1,2763 @@ +#pragma once +#include "windows.h" +#include +#include +#include +#include +#include +#include +#include +#include +#include "TimeSpan.h" +#include "NativeFunc.h" +#include "List.h" +#pragma comment(lib,"Gdi32.lib") +//only Ansi for text encoding in this lib + + + +#define var auto +using namespace std; +extern "C" void* CoreRT_StaticInitialization(); + + +namespace System +{ + class Random + { + private: + IntPtr _p; + public: + ~Random() + { + System_IntPtr_Free(this->_p); + } + Random() + { + this->_p = System_Random_New(); + } + Random(int seed) + { + this->_p = System_Random_NewI(seed); + } + int Next() + { + return System_Random_NextI(this->_p); + } + int Next(int max) + { + return System_Random_NextII(this->_p , max); + } + int Next(int min , int max) + { + return System_Random_NextIII(this->_p , min , max); + } + double NextDouble() + { + return System_Random_NextDouble(this->_p); + } + BYTE* NextBytes(int len) + { + return System_Random_NextBytes(this->_p , len); + } + }; + class Console + { + public: + static char* ReadLine() + { + return System_Console_ReadLine(); + } + static void WriteLine(const char* s = "") + { + System_Console_WriteLine(s); + } + static char ReadKey() + { + return System_Console_ReadKey(); + } + static void Write(const char* s) + { + System_Console_Write(s); + } + }; + class Environment + { + public: + static char* CurrentDirectory() + { + return System_Environment_CurrentDirectory(); + } + static void _SetCurrentDirectory(const char* path) + { + System_Environment_SetCurrentDirectory(path); + } + }; + class Math + { + public: + static double Round(double v , int dig) + { + return System_Math_Round(v , dig); + } + }; + class Convert + { + public: + static INT16 ToInt16(const char* v) + { + return System_Convert_StringToInt16(v); + } + static INT32 ToInt32(const char* v) + { + return System_Convert_StringToInt32(v); + } + static INT64 ToInt64(const char* v) + { + return System_Convert_StringToInt64(v); + } + static UINT16 ToUInt16(const char* v) + { + return System_Convert_StringToUInt16(v); + } + static UINT32 ToUInt32(const char* v) + { + return System_Convert_StringToUInt32(v); + } + static UINT64 ToUInt64(const char* v) + { + return System_Convert_StringToUInt64(v); + } + static float ToFloat(const char* v) + { + return System_Convert_StringToFloat(v); + } + static double ToDouble(const char* v) + { + return System_Convert_StringToDouble(v); + } + static char* ToString(INT8 v) + { + return System_Convert_Int8ToString(v); + } + static char* ToString(INT16 v) + { + return System_Convert_Int16ToString(v); + } + static char* ToString(INT32 v) + { + return System_Convert_Int32ToString(v); + } + static char* ToString(INT64 v) + { + return System_Convert_Int64ToString(v); + } + static char* ToString(UINT16 v) + { + return System_Convert_UInt16ToString(v); + } + static char* ToString(UINT32 v) + { + return System_Convert_UInt32ToString(v); + } + static char* ToString(UINT64 v) + { + return System_Convert_UInt64ToString(v); + } + static char* ToString(float v) + { + return System_Convert_FloatToString(v); + } + static char* ToString(double v) + { + return System_Convert_DoubleToString(v); + } + static char* ToBase64String(BYTE* v , int len) + { + return System_Convert_ToBase64String(v , len); + } + static BYTE* FromBase64String(char* v , int* lentmp) + { + return System_Convert_FromBase64String(v , lentmp); + } + }; + class DateTime + { + public: + IntPtr _t; + DateTime() + {} + DateTime(int year , int mounth , int day , int hour , int minute , int second , int millisecond) + { + this->_t = System_DateTime_New(year , mounth , day , hour , minute , second , millisecond); + } + char* ToString() + { + return System_DateTime_ToString(this->_t); + } + static DateTime* Parse(const char* time) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_Parse(time); + return result; + } + static DateTime* Now() + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_Now(); + return result; + } + DateTime* Add(TimeSpan span) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_Add(this->_t , span); + return result; + } + DateTime* AddDays(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddDays(this->_t , v); + return result; + } + DateTime* AddSeconds(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddSeconds(this->_t , v); + return result; + } + DateTime* AddMinutes(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddMinutes(this->_t , v); + return result; + } + DateTime* AddHours(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddHours(this->_t , v); + return result; + } + DateTime* AddMilliseconds(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddMilliseconds(this->_t , v); + return result; + } + DateTime* AddYears(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddYears(this->_t , v); + return result; + } + DateTime* AddTicks(int v) + { + DateTime* result = new DateTime(); + result->_t = System_DateTime_AddTicks(this->_t , v); + return result; + } + int Year() + { + return System_DateTime_Year(this->_t); + } + int Month() + { + return System_DateTime_Month(this->_t); + } + int Day() + { + return System_DateTime_Day(this->_t); + } + int Hour() + { + return System_DateTime_Hour(this->_t); + } + int Minute() + { + return System_DateTime_Minute(this->_t); + } + int Second() + { + return System_DateTime_Second(this->_t); + } + int Millisecond() + { + return System_DateTime_Millisecond(this->_t); + } + INT64 Ticks() + { + return System_DateTime_Ticks(this->_t); + } + }; + namespace Text + { + class StringBuilder + { + IntPtr _b; + public: + StringBuilder() + { + this->_b = System_Text_StringBuilder_New(); + } + StringBuilder(const char* s) + { + this->_b = System_Text_StringBuilder_NewI(s); + } + ~StringBuilder() + { + free(this->_b); + } + void Append(const char* s) + { + System_Text_StringBuilder_Append(this->_b , s); + } + void AppendLine(const char* s) + { + System_Text_StringBuilder_AppendLine(this->_b , s); + } + void Insert(int index , const char* s) + { + System_Text_StringBuilder_Insert(this->_b , index , s); + } + int GetLength() + { + return System_Text_StringBuilder_GetLength(this->_b); + } + void SetLength(int len) + { + return System_Text_StringBuilder_SetLength(this->_b , len); + } + void Clear() + { + System_Text_StringBuilder_Clear(this->_b); + } + char* ToString() + { + return System_Text_StringBuilder_ToString(this->_b); + } + }; + class Encoding + { + public: + IntPtr _p; + static Encoding* Default() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_Default(); + return result; + } + static Encoding* UTF7() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_UTF7(); + return result; + } + static Encoding* UTF8() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_UTF8(); + return result; + } + static Encoding* UTF32() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_UTF32(); + return result; + } + static Encoding* Latin1() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_Latin1(); + return result; + } + static Encoding* Unicode() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_Unicode(); + return result; + } + static Encoding* ASCII() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_ASCII(); + return result; + } + static Encoding* BigEndianUnicode() + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_BigEndianUnicode(); + return result; + } + static Encoding* GetEncoding(const char* name) + { + Encoding* result = new Encoding(); + result->_p = System_Text_Encoding_GetEncoding(name); + return result; + } + BYTE* GetBytes(const char* str , int* outlen) + { + return System_Text_Encoding_GetBytes(this->_p , str , outlen); + } + char* GetString(BYTE* bytes , int len) + { + return System_Text_Encoding_GetString(this->_p , bytes , len); + } + }; + namespace RegularExpressions + { + class Regex + { + private: + const char* pattem; + public: + Regex(const char* _pattem) + { + this->pattem = _pattem; + } + vector Matches(const char* text) + { + const char** tmp = 0; + int count = 0; + System_Text_RegularExpressions_Regex_Matches(text , this->pattem , &tmp , &count); + vector result = vector(); + for(int i = 0; i < count; i++) + { + result.push_back(tmp[i]); + } + return result; + } + static vector Matches(const char* text , const char* pat) + { + const char** tmp = 0; + int count = 0; + System_Text_RegularExpressions_Regex_Matches(text , pat , &tmp , &count); + vector result = vector(); + for(int i = 0; i < count; i++) + { + result.push_back(tmp[i]); + } + return result; + } + vector Split(const char* text) + { + const char** tmp = 0; + int count = 0; + System_Text_RegularExpressions_Regex_Slpite(text , this->pattem , &tmp , &count); + vector result = vector(); + for(int i = 0; i < count; i++) + { + result.push_back(tmp[i]); + } + return result; + } + static vector Split(const char* text , const char* pat) + { + const char** tmp = 0; + int count = 0; + System_Text_RegularExpressions_Regex_Slpite(text , pat , &tmp , &count); + vector result = vector(); + for(int i = 0; i < count; i++) + { + result.push_back(tmp[i]); + } + return result; + } + char* Replace(const char* text , const char* replacement) + { + return System_Text_RegularExpressions_Regex_Replace(text , this->pattem , replacement); + } + static char* Replace(const char* text , const char* pat , const char* replacement) + { + return System_Text_RegularExpressions_Regex_Replace(text , pat , replacement); + } + }; + } + } + namespace IO + { + using namespace System::Text; + class MemoryStream + { + public: + IntPtr _p; + MemoryStream() + { + this->_p = System_IO_MemoryStream_New(); + } + ~MemoryStream() + { + System_IntPtr_Free(this->_p); + } + MemoryStream(BYTE* v , INT32 len) + { + this->_p = System_IO_MemoryStream_NewI(v , len); + } + void Seek(long offset , SeekOrigin loc) + { + System_IO_MemoryStream_Seek(this->_p , offset , loc); + } + INT64 GetPosition() + { + return System_IO_MemoryStream_GetPosition(this->_p); + } + void GetPosition(INT64 len) + { + System_IO_MemoryStream_SetPosition(this->_p , len); + } + INT64 GetLength() + { + return System_IO_MemoryStream_GetLength(this->_p); + } + void SetLength(INT64 len) + { + System_IO_MemoryStream_SetLength(this->_p , len); + } + void Write(BYTE* buffer , INT32 len) + { + System_IO_MemoryStream_Write(this->_p , buffer , len); + } + void WriteByte(BYTE _byte) + { + System_IO_MemoryStream_WriteByte(this->_p , _byte); + } + int Read(BYTE* buffer , int offset , int len) + { + return System_IO_MemoryStream_Read(this->_p , buffer , offset , len); + } + int ReadByte() + { + return System_IO_MemoryStream_ReadByte(this->_p); + } + BYTE* ToArray() + { + return System_IO_MemoryStream_ToArray(this->_p); + } + }; + class Stream + { + public: + IntPtr _p; + const IntPtr Null = System_IO_Stream_Null(); + Stream& operator =(MemoryStream& ms) + { + this->_p = System_IO_Stream_FROMMEMORYSTREAM(ms._p); + return *this; + } + bool CanRead() + { + return System_IO_Stream_CanRead(this->_p); + } + bool CanSeek() + { + return System_IO_Stream_CanSeek(this->_p); + } + bool CanTimeout() + { + return System_IO_Stream_CanTimeout(this->_p); + } + bool CanWrite() + { + return System_IO_Stream_CanWrite(this->_p); + } + long Length() + { + return System_IO_Stream_Length(this->_p); + } + long GetPosition() + { + return System_IO_Stream_GetPosition(this->_p); + } + void SetPosition(long position) + { + return System_IO_Stream_SetPosition(this->_p , position); + } + int GetReadTimeout() + { + return System_IO_Stream_GetReadTimeout(this->_p); + } + void SetReadTimeout(int ReadTimeout) + { + return System_IO_Stream_SetReadTimeout(this->_p , ReadTimeout); + } + int GetWriteTimeout() + { + return System_IO_Stream_GetWriteTimeout(this->_p); + } + void SetWriteTimeout(int WriteTimeout) + { + return System_IO_Stream_SetWriteTimeout(this->_p , WriteTimeout); + } + void Write(byte* data , int len) + { + System_IO_Stream_Write(this->_p , data , len); + } + void WriteByte(byte data) + { + System_IO_Stream_WriteByte(this->_p , data); + } + int ReadByte() + { + return System_IO_Stream_ReadByte(this->_p); + } + int Read(IntPtr buffer , int offset , int len) + { + return System_IO_Stream_Read(this->_p , buffer , offset , len); + } + + }; + class StreamReader + { + public: + IntPtr _p; StreamReader(int) + {} + StreamReader(System::IO::Stream& stream) + { + this->_p = System_IO_StreamReader_New(stream._p); + } + StreamReader(System::IO::Stream& stream , bool detectEncodingFromByteOrderMarks) + { + this->_p = System_IO_StreamReader_NewI(stream._p , detectEncodingFromByteOrderMarks); + } + StreamReader(System::IO::Stream& stream , System::Text::Encoding* encoding) + { + this->_p = System_IO_StreamReader_NewII(stream._p , encoding->_p); + } + StreamReader(System::IO::Stream& stream , System::Text::Encoding* encoding , bool detect) + { + this->_p = System_IO_StreamReader_NewIII(stream._p , encoding->_p , detect); + } + StreamReader(System::IO::Stream& stream , System::Text::Encoding* encoding , bool detect , int buffersize) + { + this->_p = System_IO_StreamReader_NewIV(stream._p , encoding->_p , detect , buffersize); + } + StreamReader(System::IO::Stream& stream , System::Text::Encoding* encoding , bool detect , int buffersize , bool leaveOpen) + { + this->_p = System_IO_StreamReader_NewV(stream._p , encoding->_p , detect , buffersize , leaveOpen); + } + StreamReader(const char* path) + { + this->_p = System_IO_StreamReader_NewVI(path); + } + StreamReader(const char* path , bool detect) + { + this->_p = System_IO_StreamReader_NewVII(path , detect); + } + StreamReader(const char* path , System::Text::Encoding* encoding) + { + this->_p = System_IO_StreamReader_NewVIII(path , encoding->_p); + } + StreamReader(const char* path , System::Text::Encoding* encoding , bool detect) + { + this->_p = System_IO_StreamReader_NewX(path , encoding->_p , detect); + } + StreamReader(const char* path , System::Text::Encoding* encoding , bool detect , int buffersize) + { + this->_p = System_IO_StreamReader_NewXI(path , encoding->_p , detect , buffersize); + } + void Close() + { + return System_IO_StreamReader_Close(this->_p); + } + void Peek() + { + return System_IO_StreamReader_Peek(this->_p); + } + void DiscardBufferedData() + { + return System_IO_StreamReader_DiscardBufferedData(this->_p); + } + int Read(IntPtr stream , char* buffer , int index , int count) + { + return System_IO_StreamReader_Read(this->_p , buffer , index , count); + } + char* ReadLine() + { + return System_IO_StreamReader_ReadLine(this->_p); + } + char* ReadToEnd() + { + return System_IO_StreamReader_ReadToEnd(this->_p); + } + }; + class StreamWriter + { + public: + IntPtr _p; + StreamWriter(int) + {} + StreamWriter(System::IO::Stream& stream) + { + this->_p = System_IO_StreamWriter_New(stream._p); + } + StreamWriter(System::IO::Stream& stream , System::Text::Encoding* encoding) + { + this->_p = System_IO_StreamWriter_NewI(stream._p , encoding->_p); + } + StreamWriter(System::IO::Stream& stream , System::Text::Encoding* encoding , int buffersize) + { + this->_p = System_IO_StreamWriter_NewII(stream._p , encoding->_p , buffersize); + } + StreamWriter(System::IO::Stream& stream , System::Text::Encoding* encoding , int buffersize , bool leaveOpen) + { + this->_p = System_IO_StreamWriter_NewIII(stream._p , encoding->_p , buffersize , leaveOpen); + } + StreamWriter(const char* path) + { + this->_p = System_IO_StreamWriter_NewIV(path); + } + StreamWriter(const char* path , bool append) + { + this->_p = System_IO_StreamWriter_NewV(path , append); + } + StreamWriter(const char* path , bool append , System::Text::Encoding* encoding) + { + this->_p = System_IO_StreamWriter_NewVI(path , append , encoding->_p); + } + StreamWriter(const char* path , bool append , System::Text::Encoding* encoding , int buffersize) + { + this->_p = System_IO_StreamWriter_NewVII(path , append , encoding->_p , buffersize); + } + void Close() + { + return System_IO_StreamWriter_Close(this->_p); + } + void Flush() + { + return System_IO_StreamWriter_Flush(this->_p); + } + bool GetAutoFlush() + { + return System_IO_StreamWriter_GetAutoFlush(this->_p); + } + void SetAutoFlush(bool AutoFlush) + { + System_IO_StreamWriter_SetAutoFlush(this->_p , AutoFlush); + } + void WriteChar(char c) + { + return System_IO_StreamWriter_WriteChar(this->_p , c); + } + void Write(const char* s) + { + return System_IO_StreamWriter_Write(this->_p , s); + } + void WriteLine(const char* s) + { + return System_IO_StreamWriter_WriteLine(this->_p , s); + } + }; + class FileStream + { + public: + IntPtr _p; + FileStream(const char* path , FileMode fmode , FileAccess acc) + { + this->_p = System_IO_FileStream_New(path , fmode , acc); + } + FileStream(IntPtr fhandle , FileAccess acc) + { + this->_p = System_IO_FileStream_NewI(fhandle , acc); + } + long GetPosition() + { + return System_IO_FileStream_GetPosition(this->_p); + } + void SetPosition(long pos) + { + System_IO_FileStream_SetPosition(this->_p , pos); + } + long GetLength() + { + return System_IO_FileStream_GetLength(this->_p); + } + void SetLength(long len) + { + System_IO_FileStream_SetLength(this->_p , len); + } + void Write(BYTE* _buffer , int len) + { + System_IO_FileStream_Write(this->_p , _buffer , len); + } + void WriteByte(BYTE b) + { + System_IO_FileStream_WriteByte(this->_p , b); + } + int Read(BYTE* buffer , int offset , int len) + { + return System_IO_FileStream_Read(this->_p , buffer , offset , len); + } + int ReadByte() + { + return System_IO_FileStream_ReadByte(this->_p); + } + void Seek(long offset , SeekOrigin loc) + { + System_IO_FileStream_Seek(this->_p , offset , loc); + } + void Flush() + { + System_IO_FileStream_Flush(this->_p); + } + void FlushI(bool flushToDisk) + { + System_IO_FileStream_FlushI(this->_p , flushToDisk); + } + }; + class BinaryReader + { + public: + IntPtr _p; + BinaryReader(MemoryStream& ms) + { + this->_p = System_IO_BinaryReader_New(ms._p); + } + BinaryReader(FileStream& fs) + { + this->_p = System_IO_BinaryReader_NewI(fs._p); + } + BinaryReader(Stream& stream) + { + this->_p = System_IO_BinaryReader_NewII(stream._p); + } + byte ReadByte() + { + return System_IO_BinaryReader_ReadByte(this->_p); + } + char ReadChar() + { + return System_IO_BinaryReader_ReadChar(this->_p); + } + Int16 ReadInt16() + { + return System_IO_BinaryReader_ReadInt16(this->_p); + } + UInt16 ReadUInt16() + { + return System_IO_BinaryReader_ReadUInt16(this->_p); + } + Int32 ReadInt32() + { + return System_IO_BinaryReader_ReadInt32(this->_p); + } + UInt32 ReadUInt32() + { + return System_IO_BinaryReader_ReadUInt32(this->_p); + } + Int64 ReadInt64() + { + return System_IO_BinaryReader_ReadInt64(this->_p); + } + UInt64 ReadUInt64() + { + return System_IO_BinaryReader_ReadUInt64(this->_p); + } + IntPtr ReadBytes(int len) + { + return System_IO_BinaryReader_ReadBytes(this->_p , len); + } + }; + class BinaryWriter + { + public: + IntPtr _p; + BinaryWriter(MemoryStream& ms) + { + this->_p = System_IO_BinaryWriter_New(ms._p); + } + BinaryWriter(FileStream& fs) + { + this->_p = System_IO_BinaryWriter_NewI(fs._p); + } + BinaryWriter(Stream& stream) + { + this->_p = System_IO_BinaryWriter_NewII(stream._p); + } + void Write(bool b) + { + System_IO_BinaryWriter_WriteI(this->_p , b); + } + void Write(byte b) + { + System_IO_BinaryWriter_WriteII(this->_p , b); + } + void Write(Int16 v) + { + System_IO_BinaryWriter_WriteIII(this->_p , v); + } + void Write(Int32 v) + { + System_IO_BinaryWriter_WriteIV(this->_p , v); + } + void Write(Int64 v) + { + System_IO_BinaryWriter_WriteV(this->_p , v); + } + void Write(float v) + { + System_IO_BinaryWriter_WriteVI(this->_p , v); + } + void Write(double v) + { + System_IO_BinaryWriter_WriteVII(this->_p , v); + } + void Write(IntPtr buffer , int len) + { + System_IO_BinaryWriter_WriteVIII(this->_p , buffer , len); + } + + }; + class File + { + public: + static bool Exists(const char* path) + { + return System_IO_File_Exists(path); + } + static void Delete(const char* path) + { + System_IO_File_Delete(path); + } + static char* ReadAllText(const char* path) + { + return System_IO_File_ReadAllText(path); + } + static BYTE* ReadAllBytes(const char* path) + { + return System_IO_File_ReadAllBytes(path); + } + + static void WriteAllText(const char* path , const char* text) + { + System_IO_File_WriteAllText(path , text); + } + static void WriteAllBytes(const char* path , BYTE* buffer , int len) + { + System_IO_File_WriteAllBytes(path , buffer , len); + } + static void AppendAllText(const char* path , const char* text) + { + System_IO_File_AppendAllText(path , text); + } + static INT64 GetSize(const char* path) + { + return System_IO_File_GetSize(path); + } + }; + class Directory + { + public: + static void Delete(const char* path) + { + return System_IO_Directory_Delete(path); + } + static void Create(const char* path) + { + return System_IO_Directory_CreateDirectory(path); + } + static bool Exists(const char* path) + { + return System_IO_Directory_Exists(path); + } + static vector GetFiles(const char* path) + { + int len = 0; + auto ps = System_IO_Directory_GetFiles(path , &len); + vector result; + for(int i = 0; i < len; i++) + { + result.push_back(ps[i]); + } + return result; + } + static vector GetDirectories(const char* path) + { + int len = 0; + auto ps = System_IO_Directory_GetDirectories(path , &len); + vector result; + for(int i = 0; i < len; i++) + { + result.push_back(ps[i]); + } + return result; + } + }; + namespace Compression + { + class Compress + { + public: + static BYTE* DoCompress(BYTE* val , int len , int* o_len) + { + return System_IO_Compression_Compress(val , len , o_len); + } + static BYTE* Decompress(BYTE* val , int len , int* o_len) + { + return System_IO_Compression_Decompress(val , len , o_len); + } + }; + } + } + namespace Diagnostics + { + using namespace System::IO; + class Stopwatch + { + //private: + // tf; + //public: + // static Stopwatch* StartNew() + // { + // Stopwatch* st = new Stopwatch(); + // st->stf = System_Diagnostics_Stopwatch_StartNew(); + // return st; + // } + // ~Stopwatch() + // { + // System_IntPtr_Free(this->stf); + // } + // TimeSpan Elapsed() + // { + // INT64 v = System_Diagnostics_Stopwatch_Elapsed(stf); + // TimeSpan tm = TimeSpan(v); + // return tm; + // } + // void Stop() + // { + // System_Diagnostics_Stopwatch_Stop(stf); + // } + // void Restart() + // { + // System_Diagnostics_Stopwatch_Restart(stf); + // } + static long long toInteger(LARGE_INTEGER const& integer) + { +#ifdef INT64_MAX + return integer.QuadPart; +#else + return (static_cast(integer.HighPart) << 32) | integer.LowPart; +#endif + } + static LARGE_INTEGER toLargeInteger(long long value) + { + LARGE_INTEGER result; + +#ifdef INT64_MAX + result.QuadPart = value; +#else + result.high_part = value & 0xFFFFFFFF00000000; + result.low_part = value & 0xFFFFFFFF; +#endif + return result; + } + public: + BOOLEAN RUNNING = false; + LARGE_INTEGER starttime; + LARGE_INTEGER endtime; + static Stopwatch* StartNew() + { + Stopwatch* st = new Stopwatch(); + QueryPerformanceCounter(&st->starttime); + st->RUNNING = true; + return st; + } + TimeSpan Elapsed() + { + if(this->RUNNING) + { + LARGE_INTEGER _endtime; + QueryPerformanceCounter(&_endtime); + INT64 v = toInteger(_endtime) - toInteger(starttime); + TimeSpan tm = TimeSpan(v); + return tm; + } + else + { + INT64 v = toInteger(endtime) - toInteger(starttime); + TimeSpan tm = TimeSpan(v); + return tm; + } + } + void Stop() + { + this->RUNNING = false; + QueryPerformanceCounter(&this->endtime); + } + void Restart() + { + this->RUNNING = true; + QueryPerformanceCounter(&this->starttime); + } + }; + class ProcessStartInfo + { + public: + IntPtr _p; + ProcessStartInfo(int) + { } + ProcessStartInfo() + { + this->_p = System_Diagnostics_ProcessStartInfo_New(); + } + ProcessStartInfo(const char* _filename) + { + this->_p = System_Diagnostics_ProcessStartInfo_NewI(_filename); + } + ProcessStartInfo(const char* _fileName , const char* _arguments) + { + this->_p = System_Diagnostics_ProcessStartInfo_NewII(_fileName , _arguments); + } + IntPtr GetFileName() + { + return System_Diagnostics_ProcessStartInfo_GetFileName(this->_p); + } + void SetFileName(const char* filename) + { + return System_Diagnostics_ProcessStartInfo_SetFileName(this->_p , filename); + } + char* GetArguments() + { + return System_Diagnostics_ProcessStartInfo_GetArguments(this->_p); + } + void SetArguments(const char* Arguments) + { + return System_Diagnostics_ProcessStartInfo_SetArguments(this->_p , Arguments); + } + bool GetCreateNoWindow() + { + return System_Diagnostics_ProcessStartInfo_GetCreateNoWindow(this->_p); + } + void SetCreateNoWindow(bool CreateNoWindow) + { + return System_Diagnostics_ProcessStartInfo_SetCreateNoWindow(this->_p , CreateNoWindow); + } + bool GetUseShellExecute() + { + return System_Diagnostics_ProcessStartInfo_GetUseShellExecute(this->_p); + } + void SetUseShellExecute(bool UseShellExecute) + { + return System_Diagnostics_ProcessStartInfo_SetUseShellExecute(this->_p , UseShellExecute); + } + bool GetRedirectStandardInput() + { + return System_Diagnostics_ProcessStartInfo_GetRedirectStandardInput(this->_p); + } + void SetRedirectStandardInput(bool RedirectStandardInput) + { + return System_Diagnostics_ProcessStartInfo_SetRedirectStandardInput(this->_p , RedirectStandardInput); + } + bool GetRedirectStandardOutput() + { + return System_Diagnostics_ProcessStartInfo_GetRedirectStandardOutput(this->_p); + } + void SetRedirectStandardOutput(bool RedirectStandardOutput) + { + return System_Diagnostics_ProcessStartInfo_SetRedirectStandardOutput(this->_p , RedirectStandardOutput); + } + bool GetRedirectStandardError() + { + return System_Diagnostics_ProcessStartInfo_GetRedirectStandardError(this->_p); + } + void SetRedirectStandardError(bool RedirectStandardError) + { + return System_Diagnostics_ProcessStartInfo_SetRedirectStandardError(this->_p , RedirectStandardError); + } + bool GetLoadUserProfile() + { + return System_Diagnostics_ProcessStartInfo_GetLoadUserProfile(this->_p); + } + void SetLoadUserProfile(bool LoadUserProfile) + { + return System_Diagnostics_ProcessStartInfo_SetLoadUserProfile(this->_p , LoadUserProfile); + } + char* _GetUserName() + { + return System_Diagnostics_ProcessStartInfo_GetUserName(this->_p); + } + void _SetUserName(const char* UserName) + { + return System_Diagnostics_ProcessStartInfo_SetUserName(this->_p , UserName); + } + IntPtr GetVerb() + { + return System_Diagnostics_ProcessStartInfo_GetVerb(this->_p); + } + void SetVerb(const char* Verb) + { + System_Diagnostics_ProcessStartInfo_SetVerb(this->_p , Verb); + } + ProcessWindowStyle GetWindowStyle() + { + return System_Diagnostics_ProcessStartInfo_GetWindowStyle(this->_p); + } + void SetWindowStyle(ProcessWindowStyle WindowStyle) + { + System_Diagnostics_ProcessStartInfo_SetWindowStyle(this->_p , WindowStyle); + } + }; + class Process + { + public: + IntPtr _p; + Process(int) + { + //this->_p = System_Diagnostics_Process_New(); + } + Process() + { + this->_p = System_Diagnostics_Process_New(); + } + ~Process() + { + System_IntPtr_Free(this->_p); + } + bool Start() + { + return System_Diagnostics_Process_StartII(this->_p); + } + void Close() + { + System_Diagnostics_Process_Close(this->_p); + } + static Process* Start(const char* path) + { + Process* result = new Process(); + result->_p = System_Diagnostics_Process_Start(path); + } + static Process* Start(const char* path , const char* arguments) + { + Process* result = new Process(); + result->_p = System_Diagnostics_Process_StartI(path , arguments); + } + static Process* GetProcessById(int pid) + { + Process* result = new Process(0); + result->_p = System_Diagnostics_Process_GetProcessById(pid); + return result; + } + static Process* GetCurrentProcess() + { + Process* result = new Process(0); + result->_p = System_Diagnostics_Process_GetCurrentProcess(); + return result; + } + static void EnterDebugMode() + { + return System_Diagnostics_Process_EnterDebugMode(); + } + static vector GetProcesses() + { + vector result; + int len = 0; + auto res = System_Diagnostics_Process_GetProcesses(&len); + for(int i = 0; i < len; i++) + { + auto pp = new Process(0); + pp->_p = res[i]; + result.push_back(pp); + } + return result; + } + static vector GetProcesses(const char* machineName) + { + vector result; + int len = 0; + auto res = System_Diagnostics_Process_GetProcessesI(machineName , &len); + for(int i = 0; i < len; i++) + { + auto pp = new Process(0); + pp->_p = res[i]; + result.push_back(pp); + } + return result; + } + static vector GetProcessesByName(const char* processName) + { + vector result; + int len = 0; + auto res = System_Diagnostics_Process_GetProcessesByName(processName , &len); + for(int i = 0; i < len; i++) + { + auto pp = new Process(0); + pp->_p = res[i]; + result.push_back(pp); + } + return result; + } + System::IO::StreamReader* StandardError() + { + StreamReader* result = new StreamReader(0); + result->_p = System_Diagnostics_Process_StandardError(this->_p); + return result; + } + System::IO::StreamWriter* StandardInput() + { + StreamWriter* result = new StreamWriter(0); + result->_p = System_Diagnostics_Process_StandardInput(this->_p); + return result; + } + System::IO::StreamReader* StandardOutput() + { + StreamReader* result = new StreamReader(0); + result->_p = System_Diagnostics_Process_StandardOutput(this->_p); + return result; + } + ProcessStartInfo* StartInfo() + { + ProcessStartInfo* result = new ProcessStartInfo(0); + result->_p = System_Diagnostics_Process_StartInfo(this->_p); + return result; + } + void Kill() + { + System_Diagnostics_Process_Kill(this->_p); + } + void Kill(bool entireProcessTree) + { + System_Diagnostics_Process_KillI(this->_p , entireProcessTree); + } + void Refresh() + { + System_Diagnostics_Process_Refresh(this->_p); + } + void WaitForExit() + { + System_Diagnostics_Process_WaitForExit(this->_p); + } + bool WaitForExit(int milliseconds) + { + return System_Diagnostics_Process_WaitForExitI(this->_p , milliseconds); + } + void WaitForInputIdle() + { + System_Diagnostics_Process_WaitForInputIdle(this->_p); + } + bool WaitForInputIdle(int milliseconds) + { + return System_Diagnostics_Process_WaitForInputIdleI(this->_p , milliseconds); + } + int BasePriority() + { + return System_Diagnostics_Process_BasePriority(this->_p); + } + bool GetEnableRaisingEvents() + { + return System_Diagnostics_Process_GetEnableRaisingEvents(this->_p); + } + void SetEnableRaisingEvents(bool v) + { + return System_Diagnostics_Process_SetEnableRaisingEvents(this->_p , v); + } + int ExitCode() + { + return System_Diagnostics_Process_ExitCode(this->_p); + } + __DateTime ExitTime() + { + return System_Diagnostics_Process_ExitTime(this->_p); + } + IntPtr Handle() + { + return System_Diagnostics_Process_Handle(this->_p); + } + int HandleCount() + { + return System_Diagnostics_Process_HandleCount(this->_p); + } + bool HasExited() + { + return System_Diagnostics_Process_HasExited(this->_p); + } + int Id() + { + return System_Diagnostics_Process_Id(this->_p); + } + char* MachineName() + { + return System_Diagnostics_Process_MachineName(this->_p); + } + vector<_ProcessModule*> Modules() + { + int len = 0; + var mds = System_Diagnostics_Process_Modules(this->_p , &len); + vector<_ProcessModule*> result; + for(int i = 0; i < len; i++) + { + result.push_back(&mds[i]); + } + return result; + } + _ProcessModule* MainModule() + { + return System_Diagnostics_Process_MainModule(this->_p); + } + IntPtr MainWindowHandle() + { + return System_Diagnostics_Process_MainWindowHandle(this->_p); + } + char* MainWindowTitle() + { + return System_Diagnostics_Process_MainWindowTitle(this->_p); + } + IntPtr MaxWorkingSet() + { + return System_Diagnostics_Process_MaxWorkingSet(this->_p); + } + IntPtr MinWorkingSet() + { + return System_Diagnostics_Process_MinWorkingSet(this->_p); + } + long NonpagedSystemMemorySize64() + { + return System_Diagnostics_Process_NonpagedSystemMemorySize64(this->_p); + } + long PagedMemorySize64() + { + return System_Diagnostics_Process_PagedMemorySize64(this->_p); + } + long PagedSystemMemorySize64() + { + return System_Diagnostics_Process_PagedSystemMemorySize64(this->_p); + } + long PeakPagedMemorySize64(IntPtr process) + { + return System_Diagnostics_Process_PeakPagedMemorySize64(this->_p); + } + long PeakVirtualMemorySize64() + { + return System_Diagnostics_Process_PeakVirtualMemorySize64(this->_p); + } + long PeakWorkingSet64() + { + return System_Diagnostics_Process_PeakWorkingSet64(this->_p); + } + bool PriorityBoostEnabled() + { + return System_Diagnostics_Process_PriorityBoostEnabled(this->_p); + } + ProcessPriorityClass PriorityClass() + { + return System_Diagnostics_Process_PriorityClass(this->_p); + } + long PrivateMemorySize64() + { + return System_Diagnostics_Process_PrivateMemorySize64(this->_p); + } + TimeSpan PrivilegedProcessorTime() + { + return System_Diagnostics_Process_PrivilegedProcessorTime(this->_p); + } + char* ProcessName() + { + return System_Diagnostics_Process_ProcessName(this->_p); + } + IntPtr ProcessorAffinity() + { + return System_Diagnostics_Process_ProcessorAffinity(this->_p); + } + bool Responding() + { + return System_Diagnostics_Process_Responding(this->_p); + } + int SessionId() + { + return System_Diagnostics_Process_SessionId(this->_p); + } + __DateTime StartTime() + { + return System_Diagnostics_Process_StartTime(this->_p); + } + ThreadInfo* Threads(int* tlen) + { + return System_Diagnostics_Process_Threads(this->_p , tlen); + } + TimeSpan TotalProcessorTime() + { + return System_Diagnostics_Process_TotalProcessorTime(this->_p); + } + TimeSpan UserProcessorTime() + { + return System_Diagnostics_Process_UserProcessorTime(this->_p); + } + long VirtualMemorySize64() + { + return System_Diagnostics_Process_VirtualMemorySize64(this->_p); + } + long WorkingSet64() + { + return System_Diagnostics_Process_WorkingSet64(this->_p); + } + }; + } + namespace Drawing + { + using namespace System::IO; + class Bitmap + { + public: + IntPtr _bmp; + BitmapData _bmpdata; + int Width; + int Height; + Bitmap() + {} + Bitmap(int wid , int hei) + { + this->_bmp = System_Drawing_Bitmap_New(wid , hei); + _bmpdata = this->Lock(); + this->Width = _bmpdata.width; + this->Height = _bmpdata.height; + this->UnLock(); + } + Bitmap(const char* path) + { + this->_bmp = System_Drawing_Bitmap_NewI(path); + _bmpdata = this->Lock(); + this->Width = _bmpdata.width; + this->Height = _bmpdata.height; + this->UnLock(); + } + Bitmap(MemoryStream* ms) + { + auto buffer = ms->ToArray(); + BITMAPFILEHEADER* bmfh; + bmfh = (BITMAPFILEHEADER*)buffer; + BITMAPINFOHEADER* bmih; + bmih = (BITMAPINFOHEADER*)(buffer + sizeof(BITMAPFILEHEADER)); + BITMAPINFO* bmi; + bmi = (BITMAPINFO*)bmih; + PVOID bits; + bits = (void*)(buffer + bmfh->bfOffBits); + HDC hdc = GetDC(NULL); + HBITMAP hbmp = CreateDIBitmap(hdc , bmih , CBM_INIT , bits , bmi , DIB_RGB_COLORS); + this->_bmp = System_Drawing_Bitmap_NewIII(hbmp); + _bmpdata = this->Lock(); + this->Width = _bmpdata.width; + this->Height = _bmpdata.height; + this->UnLock(); + } + ~Bitmap() + { + System_IntPtr_Free(this->_bmp); + } + static Bitmap* FromHBITMAP(IntPtr p) + { + auto bm = System_Drawing_Bitmap_NewIII(p); + Bitmap* bmp = new Bitmap(); + bmp->_bmp = bm; + return bmp; + } + BitmapData Lock() + { + this->_bmpdata = System_Drawing_Bitmap_Lock(this->_bmp); + return this->_bmpdata; + } + void UnLock() + { + System_Drawing_Bitmap_UnLock(this->_bmp , this->_bmpdata); + } + void Save(const char* path) + { + System_Drawing_Bitmap_Save(this->_bmp , path); + } + BOOL Save(MemoryStream* ms) + { + HBITMAP hBitmap = (HBITMAP)this->GetHbitmap(); + HDC hDC; + int iBits; + WORD wBitCount; + DWORD dwPaletteSize = 0 , dwBmBitsSize = 0 , dwDIBSize = 0 , dwWritten = 0; + BITMAP Bitmap; + BITMAPFILEHEADER bmfHdr; + BITMAPINFOHEADER bi; + LPBITMAPINFOHEADER lpbi; + HANDLE hDib , hPal , hOldPal = NULL; + hDC = CreateDC(L"DISPLAY" , NULL , NULL , NULL); + iBits = GetDeviceCaps(hDC , BITSPIXEL) * GetDeviceCaps(hDC , PLANES); + DeleteDC(hDC); + if(iBits <= 1) + wBitCount = 1; + else if(iBits <= 4) + wBitCount = 4; + else if(iBits <= 8) + wBitCount = 8; + else + wBitCount = 24; + GetObject(hBitmap , sizeof(Bitmap) , (LPSTR)&Bitmap); + bi.biSize = sizeof(BITMAPINFOHEADER); + bi.biWidth = Bitmap.bmWidth; + bi.biHeight = Bitmap.bmHeight; + bi.biPlanes = 1; + bi.biBitCount = wBitCount; + bi.biCompression = BI_RGB; + bi.biSizeImage = 0; + bi.biXPelsPerMeter = 0; + bi.biYPelsPerMeter = 0; + bi.biClrImportant = 0; + bi.biClrUsed = 0; + dwBmBitsSize = ((Bitmap.bmWidth * wBitCount + 31) / 32) * 4 * Bitmap.bmHeight; + hDib = GlobalAlloc(GHND , dwBmBitsSize + dwPaletteSize + sizeof(BITMAPINFOHEADER)); + lpbi = (LPBITMAPINFOHEADER)GlobalLock(hDib); + *lpbi = bi; + hPal = GetStockObject(DEFAULT_PALETTE); + if(hPal) + { + hDC = GetDC(NULL); + hOldPal = SelectPalette(hDC , (HPALETTE)hPal , FALSE); + RealizePalette(hDC); + } + GetDIBits(hDC , hBitmap , 0 , (UINT)Bitmap.bmHeight , + (LPSTR)lpbi + sizeof(BITMAPINFOHEADER) + dwPaletteSize , + (BITMAPINFO*)lpbi , DIB_RGB_COLORS); + if(hOldPal) + { + SelectPalette(hDC , (HPALETTE)hOldPal , TRUE); + RealizePalette(hDC); + ReleaseDC(NULL , hDC); + } + bmfHdr.bfType = 0x4D42; //"BM" + dwDIBSize = sizeof(BITMAPFILEHEADER) + sizeof(BITMAPINFOHEADER) + dwPaletteSize + dwBmBitsSize; + bmfHdr.bfSize = dwDIBSize; + bmfHdr.bfReserved1 = 0; + bmfHdr.bfReserved2 = 0; + bmfHdr.bfOffBits = (DWORD)sizeof(BITMAPFILEHEADER) + (DWORD)sizeof(BITMAPINFOHEADER) + dwPaletteSize; + ms->Write((BYTE*)&bmfHdr , sizeof(BITMAPFILEHEADER)); + ms->Write((BYTE*)lpbi , dwDIBSize); + GlobalUnlock(hDib); + GlobalFree(hDib); + return TRUE; + + } + int GetPixel(int x , int y) + { + return System_Drawing_Bitmap_GetPixel(this->_bmp , x , y); + } + void SetPixel(int x , int y , int c) + { + return System_Drawing_Bitmap_SetPixel(this->_bmp , x , y , c); + } + HANDLE GetHbitmap() + { + return System_Drawing_Bitmap_GetHbitmap(this->_bmp); + } + }; + /// + /// Ԥɫصָ벻ͷţͷź޷ʹøԤɫ + /// + class Pens + { + public: + static IntPtr Transparent() + { + return System_Drawing_Pens_Transparent(); + } + static IntPtr AliceBlue() + { + return System_Drawing_Pens_AliceBlue(); + } + static IntPtr AntiqueWhite() + { + return System_Drawing_Pens_AntiqueWhite(); + } + static IntPtr Aqua() + { + return System_Drawing_Pens_Aqua(); + } + static IntPtr Aquamarine() + { + return System_Drawing_Pens_Aquamarine(); + } + static IntPtr Azure() + { + return System_Drawing_Pens_Azure(); + } + static IntPtr Beige() + { + return System_Drawing_Pens_Beige(); + } + static IntPtr Bisque() + { + return System_Drawing_Pens_Bisque(); + } + static IntPtr Black() + { + return System_Drawing_Pens_Black(); + } + static IntPtr BlanchedAlmond() + { + return System_Drawing_Pens_BlanchedAlmond(); + } + static IntPtr Blue() + { + return System_Drawing_Pens_Blue(); + } + static IntPtr BlueViolet() + { + return System_Drawing_Pens_BlueViolet(); + } + static IntPtr Brown() + { + return System_Drawing_Pens_Brown(); + } + static IntPtr BurlyWood() + { + return System_Drawing_Pens_BurlyWood(); + } + static IntPtr CadetBlue() + { + return System_Drawing_Pens_CadetBlue(); + } + static IntPtr Chartreuse() + { + return System_Drawing_Pens_Chartreuse(); + } + static IntPtr Chocolate() + { + return System_Drawing_Pens_Chocolate(); + } + static IntPtr Coral() + { + return System_Drawing_Pens_Coral(); + } + static IntPtr CornflowerBlue() + { + return System_Drawing_Pens_CornflowerBlue(); + } + static IntPtr Cornsilk() + { + return System_Drawing_Pens_Cornsilk(); + } + static IntPtr Crimson() + { + return System_Drawing_Pens_Crimson(); + } + static IntPtr Cyan() + { + return System_Drawing_Pens_Cyan(); + } + static IntPtr DarkBlue() + { + return System_Drawing_Pens_DarkBlue(); + } + static IntPtr DarkCyan() + { + return System_Drawing_Pens_DarkCyan(); + } + static IntPtr DarkGoldenrod() + { + return System_Drawing_Pens_DarkGoldenrod(); + } + static IntPtr DarkGray() + { + return System_Drawing_Pens_DarkGray(); + } + static IntPtr DarkGreen() + { + return System_Drawing_Pens_DarkGreen(); + } + static IntPtr DarkKhaki() + { + return System_Drawing_Pens_DarkKhaki(); + } + static IntPtr DarkMagenta() + { + return System_Drawing_Pens_DarkMagenta(); + } + static IntPtr DarkOliveGreen() + { + return System_Drawing_Pens_DarkOliveGreen(); + } + static IntPtr DarkOrange() + { + return System_Drawing_Pens_DarkOrange(); + } + static IntPtr DarkOrchid() + { + return System_Drawing_Pens_DarkOrchid(); + } + static IntPtr DarkRed() + { + return System_Drawing_Pens_DarkRed(); + } + static IntPtr DarkSalmon() + { + return System_Drawing_Pens_DarkSalmon(); + } + static IntPtr DarkSeaGreen() + { + return System_Drawing_Pens_DarkSeaGreen(); + } + static IntPtr DarkSlateBlue() + { + return System_Drawing_Pens_DarkSlateBlue(); + } + static IntPtr DarkSlateGray() + { + return System_Drawing_Pens_DarkSlateGray(); + } + static IntPtr DarkTurquoise() + { + return System_Drawing_Pens_DarkTurquoise(); + } + static IntPtr DarkViolet() + { + return System_Drawing_Pens_DarkViolet(); + } + static IntPtr DeepPink() + { + return System_Drawing_Pens_DeepPink(); + } + static IntPtr DeepSkyBlue() + { + return System_Drawing_Pens_DeepSkyBlue(); + } + static IntPtr DimGray() + { + return System_Drawing_Pens_DimGray(); + } + static IntPtr DodgerBlue() + { + return System_Drawing_Pens_DodgerBlue(); + } + static IntPtr Firebrick() + { + return System_Drawing_Pens_Firebrick(); + } + static IntPtr FloralWhite() + { + return System_Drawing_Pens_FloralWhite(); + } + static IntPtr ForestGreen() + { + return System_Drawing_Pens_ForestGreen(); + } + static IntPtr Fuchsia() + { + return System_Drawing_Pens_Fuchsia(); + } + static IntPtr Gainsboro() + { + return System_Drawing_Pens_Gainsboro(); + } + static IntPtr GhostWhite() + { + return System_Drawing_Pens_GhostWhite(); + } + static IntPtr Gold() + { + return System_Drawing_Pens_Gold(); + } + static IntPtr Goldenrod() + { + return System_Drawing_Pens_Goldenrod(); + } + static IntPtr Gray() + { + return System_Drawing_Pens_Gray(); + } + static IntPtr Green() + { + return System_Drawing_Pens_Green(); + } + static IntPtr GreenYellow() + { + return System_Drawing_Pens_GreenYellow(); + } + static IntPtr Honeydew() + { + return System_Drawing_Pens_Honeydew(); + } + static IntPtr HotPink() + { + return System_Drawing_Pens_HotPink(); + } + static IntPtr IndianRed() + { + return System_Drawing_Pens_IndianRed(); + } + static IntPtr Indigo() + { + return System_Drawing_Pens_Indigo(); + } + static IntPtr Ivory() + { + return System_Drawing_Pens_Ivory(); + } + static IntPtr Khaki() + { + return System_Drawing_Pens_Khaki(); + } + static IntPtr Lavender() + { + return System_Drawing_Pens_Lavender(); + } + static IntPtr LavenderBlush() + { + return System_Drawing_Pens_LavenderBlush(); + } + static IntPtr LawnGreen() + { + return System_Drawing_Pens_LawnGreen(); + } + static IntPtr LemonChiffon() + { + return System_Drawing_Pens_LemonChiffon(); + } + static IntPtr LightBlue() + { + return System_Drawing_Pens_LightBlue(); + } + static IntPtr LightCoral() + { + return System_Drawing_Pens_LightCoral(); + } + static IntPtr LightCyan() + { + return System_Drawing_Pens_LightCyan(); + } + static IntPtr LightGoldenrodYellow() + { + return System_Drawing_Pens_LightGoldenrodYellow(); + } + static IntPtr LightGreen() + { + return System_Drawing_Pens_LightGreen(); + } + static IntPtr LightGray() + { + return System_Drawing_Pens_LightGray(); + } + static IntPtr LightPink() + { + return System_Drawing_Pens_LightPink(); + } + static IntPtr LightSalmon() + { + return System_Drawing_Pens_LightSalmon(); + } + static IntPtr LightSeaGreen() + { + return System_Drawing_Pens_LightSeaGreen(); + } + static IntPtr LightSkyBlue() + { + return System_Drawing_Pens_LightSkyBlue(); + } + static IntPtr LightSlateGray() + { + return System_Drawing_Pens_LightSlateGray(); + } + static IntPtr LightSteelBlue() + { + return System_Drawing_Pens_LightSteelBlue(); + } + static IntPtr LightYellow() + { + return System_Drawing_Pens_LightYellow(); + } + static IntPtr Lime() + { + return System_Drawing_Pens_Lime(); + } + static IntPtr LimeGreen() + { + return System_Drawing_Pens_LimeGreen(); + } + static IntPtr Linen() + { + return System_Drawing_Pens_Linen(); + } + static IntPtr Magenta() + { + return System_Drawing_Pens_Magenta(); + } + static IntPtr Maroon() + { + return System_Drawing_Pens_Maroon(); + } + static IntPtr MediumAquamarine() + { + return System_Drawing_Pens_MediumAquamarine(); + } + static IntPtr MediumBlue() + { + return System_Drawing_Pens_MediumBlue(); + } + static IntPtr MediumOrchid() + { + return System_Drawing_Pens_MediumOrchid(); + } + static IntPtr MediumPurple() + { + return System_Drawing_Pens_MediumPurple(); + } + static IntPtr MediumSeaGreen() + { + return System_Drawing_Pens_MediumSeaGreen(); + } + static IntPtr MediumSlateBlue() + { + return System_Drawing_Pens_MediumSlateBlue(); + } + static IntPtr MediumSpringGreen() + { + return System_Drawing_Pens_MediumSpringGreen(); + } + static IntPtr MediumTurquoise() + { + return System_Drawing_Pens_MediumTurquoise(); + } + static IntPtr MediumVioletRed() + { + return System_Drawing_Pens_MediumVioletRed(); + } + static IntPtr MidnightBlue() + { + return System_Drawing_Pens_MidnightBlue(); + } + static IntPtr MintCream() + { + return System_Drawing_Pens_MintCream(); + } + static IntPtr MistyRose() + { + return System_Drawing_Pens_MistyRose(); + } + static IntPtr Moccasin() + { + return System_Drawing_Pens_Moccasin(); + } + static IntPtr NavajoWhite() + { + return System_Drawing_Pens_NavajoWhite(); + } + static IntPtr Navy() + { + return System_Drawing_Pens_Navy(); + } + static IntPtr OldLace() + { + return System_Drawing_Pens_OldLace(); + } + static IntPtr Olive() + { + return System_Drawing_Pens_Olive(); + } + static IntPtr OliveDrab() + { + return System_Drawing_Pens_OliveDrab(); + } + static IntPtr Orange() + { + return System_Drawing_Pens_Orange(); + } + static IntPtr OrangeRed() + { + return System_Drawing_Pens_OrangeRed(); + } + static IntPtr Orchid() + { + return System_Drawing_Pens_Orchid(); + } + static IntPtr PaleGoldenrod() + { + return System_Drawing_Pens_PaleGoldenrod(); + } + static IntPtr PaleGreen() + { + return System_Drawing_Pens_PaleGreen(); + } + static IntPtr PaleTurquoise() + { + return System_Drawing_Pens_PaleTurquoise(); + } + static IntPtr PaleVioletRed() + { + return System_Drawing_Pens_PaleVioletRed(); + } + static IntPtr PapayaWhip() + { + return System_Drawing_Pens_PapayaWhip(); + } + static IntPtr PeachPuff() + { + return System_Drawing_Pens_PeachPuff(); + } + static IntPtr Peru() + { + return System_Drawing_Pens_Peru(); + } + static IntPtr Pink() + { + return System_Drawing_Pens_Pink(); + } + static IntPtr Plum() + { + return System_Drawing_Pens_Plum(); + } + static IntPtr PowderBlue() + { + return System_Drawing_Pens_PowderBlue(); + } + static IntPtr Purple() + { + return System_Drawing_Pens_Purple(); + } + static IntPtr Red() + { + return System_Drawing_Pens_Red(); + } + static IntPtr RosyBrown() + { + return System_Drawing_Pens_RosyBrown(); + } + static IntPtr RoyalBlue() + { + return System_Drawing_Pens_RoyalBlue(); + } + static IntPtr SaddleBrown() + { + return System_Drawing_Pens_SaddleBrown(); + } + static IntPtr Salmon() + { + return System_Drawing_Pens_Salmon(); + } + static IntPtr SandyBrown() + { + return System_Drawing_Pens_SandyBrown(); + } + static IntPtr SeaGreen() + { + return System_Drawing_Pens_SeaGreen(); + } + static IntPtr SeaShell() + { + return System_Drawing_Pens_SeaShell(); + } + static IntPtr Sienna() + { + return System_Drawing_Pens_Sienna(); + } + static IntPtr Silver() + { + return System_Drawing_Pens_Silver(); + } + static IntPtr SkyBlue() + { + return System_Drawing_Pens_SkyBlue(); + } + static IntPtr SlateBlue() + { + return System_Drawing_Pens_SlateBlue(); + } + static IntPtr SlateGray() + { + return System_Drawing_Pens_SlateGray(); + } + static IntPtr Snow() + { + return System_Drawing_Pens_Snow(); + } + static IntPtr SpringGreen() + { + return System_Drawing_Pens_SpringGreen(); + } + static IntPtr SteelBlue() + { + return System_Drawing_Pens_SteelBlue(); + } + static IntPtr Tan() + { + return System_Drawing_Pens_Tan(); + } + static IntPtr Teal() + { + return System_Drawing_Pens_Teal(); + } + static IntPtr Thistle() + { + return System_Drawing_Pens_Thistle(); + } + static IntPtr Tomato() + { + return System_Drawing_Pens_Tomato(); + } + static IntPtr Turquoise() + { + return System_Drawing_Pens_Turquoise(); + } + static IntPtr Violet() + { + return System_Drawing_Pens_Violet(); + } + static IntPtr Wheat() + { + return System_Drawing_Pens_Wheat(); + } + static IntPtr White() + { + return System_Drawing_Pens_White(); + } + static IntPtr WhiteSmoke() + { + return System_Drawing_Pens_WhiteSmoke(); + } + static IntPtr Yellow() + { + return System_Drawing_Pens_Yellow(); + } + static IntPtr YellowGreen() + { + return System_Drawing_Pens_YellowGreen(); + } + }; + class Font + { + public: + IntPtr ptr; + Font(const char* name , float size) + { + this->ptr = System_Drawing_Font_New(name , size); + } + }; + class Graphics + { + public: + IntPtr _g; + static IntPtr NewPen(int argb , float wid) + { + return System_Drawing_Pen_New(argb , wid); + } + static Graphics* FromBitmap(Bitmap* bmp) + { + Graphics* g = new Graphics(); + g->_g = System_Drawing_Graphics_FromBitmap(bmp->_bmp); + return g; + } + static Graphics* FromHdc(HDC hdc) + { + Graphics* g = new Graphics(); + g->_g = System_Drawing_Graphics_FromHdc(hdc); + return g; + } + static Graphics* FromHwnd(HWND hwnd) + { + Graphics* g = new Graphics(); + g->_g = System_Drawing_Graphics_FromHwnd(hwnd); + return g; + } + ~Graphics() + { + System_IntPtr_Free(this->_g); + } + void Dispose() + { + this->~Graphics(); + } + void CopyFromScreen(int sleft , int stop , int dleft , int dtop , int wid , int hei) + { + System_Drawing_Graphics_CopyFromScreen(this->_g , sleft , stop , dleft , dtop , wid , hei); + } + void CopyFromScreen(int sleft , int stop , int dleft , int dtop , SIZE siz) + { + System_Drawing_Graphics_CopyFromScreen(this->_g , sleft , stop , dleft , dtop , (int)siz.cx , (int)siz.cy); + } + void CopyFromScreen(POINT sourp , POINT destp , SIZE siz) + { + System_Drawing_Graphics_CopyFromScreen(this->_g , (int)sourp.x , (int)sourp.y , (int)destp.x , (int)destp.y , (int)siz.cx , (int)siz.cy); + } + void DrawLine(IntPtr pen , float x1 , float y1 , float x2 , float y2) + { + System_Drawing_Graphics_DrawLine(this->_g , pen , x1 , y1 , x2 , y2); + } + void DrawBezier(IntPtr pen , float x1 , float y1 , float x2 , float y2 , float x3 , float y3 , float x4 , float y4) + { + System_Drawing_Graphics_DrawBezier(this->_g , pen , x1 , y1 , x2 , y2 , x3 , y3 , x4 , y4); + } + void DrawString(const char* s , IntPtr pen , Font* _fon , float x , float y) + { + System_Drawing_Graphics_DrawString(s , this->_g , pen , _fon->ptr , x , y); + } + void DrawString(const char* s , IntPtr pen , Font _fon , float x , float y) + { + System_Drawing_Graphics_DrawString(s , this->_g , pen , _fon.ptr , x , y); + } + _SizeF MeasureString(const char* s , Font _fon) + { + return System_Drawing_Graphics_MeasureString(s , this->_g , _fon.ptr); + } + _SizeF MeasureString(const char* s , Font* _fon) + { + return System_Drawing_Graphics_MeasureString(s , this->_g , _fon->ptr); + } + void DrawRectangle(IntPtr pen , float x , float y , float w , float h) + { + System_Drawing_Graphics_DrawRectangle(this->_g , pen , x , y , w , h); + } + void FillRectangle(IntPtr pen , float x , float y , float w , float h) + { + System_Drawing_Graphics_FillRectangle(this->_g , pen , x , y , w , h); + } + void DrawEllipse(IntPtr pen , float x , float y , float w , float h) + { + System_Drawing_Graphics_DrawEllipse(this->_g , pen , x , y , w , h); + } + void Fillllipse(IntPtr pen , float x , float y , float w , float h) + { + System_Drawing_Graphics_FillEllipse(this->_g , pen , x , y , w , h); + } + void DrawBitmap(Bitmap _b , float x , float y) + { + System_Drawing_Graphics_DrawBitmap(this->_g , _b._bmp , x , y); + } + void DrawBitmap(Bitmap* _b , float x , float y) + { + System_Drawing_Graphics_DrawBitmap(this->_g , _b->_bmp , x , y); + } + void DrawBitmap(Bitmap* _b , int x , int y , int w , int h , float x1 , float y1 , float w1 , float h1) + { + System_Drawing_Graphics_DrawBitmapII(this->_g , _b->_bmp , x , y , w , h , x1 , y1 , w1 , h1); + } + void DrawBitmap(Bitmap* _b , float x , float y , float wid , float hei) + { + System_Drawing_Graphics_DrawBitmapI(this->_g , _b->_bmp , x , y , wid , hei); + } + void Clear(int argb) + { + System_Drawing_Graphics_Clear(this->_g , argb); + } + }; + } + namespace Windows + { + namespace Forms + { + using namespace System::Drawing; + enum MessageBoxButtomType + { + OK = 0x00000000L , + OKCANCEL = 0x00000001L , + ABORTRETRYIGNORE = 0x00000002L , + YESNOCANCEL = 0x00000003L , + YESNO = 0x00000004L , + METRYCANCEL = 0x00000005L , + CANCELTRYCONTINUE = 0x00000006L , + }; +#undef MessageBox + class MessageBox + { + public: + static int Show(const char* text , const char* caption = "ʾ" , MessageBoxButtomType button = MessageBoxButtomType::OK) + { + return MessageBoxA(NULL , text , caption , button); + } + static int Show(HWND hwnd , const char* text , const char* caption = "ʾ" , MessageBoxButtomType button = MessageBoxButtomType::OK) + { + return MessageBoxA(hwnd , text , caption , button); + } + }; + class OpenFileDialog + { + public: + TCHAR* Title; + TCHAR* Filter; + char* FileName; + OpenFileDialog(const TCHAR* title = L"ļ" , const TCHAR* filter = L"All File(*.*)\0*.*\0") + { + this->Title = (TCHAR*)title; + this->Filter = (TCHAR*)filter; + } + bool ShowDialog() + { + TCHAR szBuffer[MAX_PATH] = { 0 }; + OPENFILENAME file = { 0 }; + file.hwndOwner = NULL; + file.lpstrTitle = this->Title; + file.lStructSize = sizeof(file); + file.lpstrFilter = this->Filter; + file.lpstrFile = szBuffer; + file.nMaxFile = sizeof(szBuffer) / sizeof(*szBuffer); + file.nFilterIndex = 0; + file.Flags = OFN_PATHMUSTEXIST | OFN_FILEMUSTEXIST | OFN_EXPLORER;//־ǶѡҪOFN_ALLOWMULTISELECT + BOOL bSel = GetOpenFileName(&file); + this->FileName = TCHAR2char(szBuffer); + return bSel; + } + }; + class SaveFileDialog + { + public: + TCHAR* Title; + TCHAR* Filter; + char* FileName; + SaveFileDialog(const TCHAR* title = L"ļ" , const TCHAR* filter = L"All File(*.*)\0*.*\0") + { + this->Title = (TCHAR*)title; + this->Filter = (TCHAR*)filter; + + } + bool ShowDialog() + { + TCHAR szBuffer[MAX_PATH] = { 0 }; + OPENFILENAME file = { 0 }; + file.hwndOwner = NULL; + file.lpstrTitle = this->Title; + file.lStructSize = sizeof(file); + file.lpstrFilter = this->Filter; + file.lpstrFile = szBuffer; + file.nMaxFile = sizeof(szBuffer) / sizeof(*szBuffer); + file.nFilterIndex = 0; + file.Flags = OFN_PATHMUSTEXIST | OFN_EXPLORER; + BOOL bSel = GetSaveFileName(&file); + this->FileName = TCHAR2char(szBuffer); + return bSel; + } + }; + class OpenFolderDialog + { + public: + TCHAR* Title; + char* SelectedPath; + OpenFolderDialog(const TCHAR* title = L"ѡļ") + { + this->Title = (TCHAR*)title; + } + bool ShowDialog() + { + TCHAR szBuffer[MAX_PATH] = { 0 }; + BROWSEINFO bi = {}; + ZeroMemory(&bi , sizeof(BROWSEINFO)); + bi.hwndOwner = NULL; + bi.pszDisplayName = szBuffer; + bi.lpszTitle = this->Title; + bi.ulFlags = BIF_RETURNFSANCESTORS; + LPITEMIDLIST idl = SHBrowseForFolder(&bi); + if(NULL == idl) + { + return false; + } + BOOL bSel = SHGetPathFromIDList(idl , szBuffer); + this->SelectedPath = TCHAR2char(szBuffer); + return bSel; + } + }; + class Clipboard + { + public: + static BOOL SetText(const char* pstr) + { + if(OpenClipboard(NULL)) + { + char* pBuf; + if(0 == EmptyClipboard()) + { + CloseClipboard(); + return false; + } + HANDLE hClip = GlobalAlloc(GMEM_MOVEABLE , strlen(pstr) + 1); + if(NULL == hClip) + { + CloseClipboard(); + return false; + } + pBuf = (char*)GlobalLock(hClip); + if(NULL == pBuf) + { + CloseClipboard(); + if(hClip) + { + CloseHandle(hClip); + } + return false; + } + memcpy(pBuf , pstr , strlen(pstr)); + GlobalUnlock(hClip); + + if(NULL == SetClipboardData(CF_TEXT , hClip)) + { + CloseClipboard(); + if(hClip) + { + CloseHandle(hClip); + } + return false; + } + CloseClipboard(); + } + return true; + } + static BOOL SetBitmap(Bitmap* bmp) + { + HANDLE bitmap = bmp->GetHbitmap(); + HBITMAP hBM = (HBITMAP)bitmap; + if(!OpenClipboard(NULL)) + { + return false; + } + EmptyClipboard(); + BITMAP bm; + GetObject(hBM , sizeof(bm) , &bm); + BITMAPINFOHEADER bi; + ZeroMemory(&bi , sizeof(BITMAPINFOHEADER)); + bi.biSize = sizeof(BITMAPINFOHEADER); + bi.biWidth = bm.bmWidth; + bi.biHeight = bm.bmHeight; + bi.biPlanes = 1; + bi.biBitCount = bm.bmBitsPixel; + bi.biCompression = BI_RGB; + if(bi.biBitCount <= 1) + { + bi.biBitCount = 1; + } + else if(bi.biBitCount <= 4) + { + bi.biBitCount = 4; + } + else if(bi.biBitCount <= 8) + { + bi.biBitCount = 8; + } + else + { + bi.biBitCount = 24; + } + SIZE_T dwColTableLen = (bi.biBitCount <= 8) ? (1 << bi.biBitCount) * sizeof(RGBQUAD) : 0; + HDC hDC = ::GetDC(NULL); + HPALETTE hPal = (HPALETTE)GetStockObject(DEFAULT_PALETTE); + HPALETTE hOldPal = ::SelectPalette(hDC , hPal , FALSE); + RealizePalette(hDC); + GetDIBits(hDC , hBM , 0 , static_cast(bi.biHeight) , NULL , (LPBITMAPINFO)&bi , DIB_RGB_COLORS); + if(0 == bi.biSizeImage) + { + bi.biSizeImage = ((((bi.biWidth * bi.biBitCount) + 31) & ~31) / 8) * bi.biHeight; + } + HGLOBAL hDIB = ::GlobalAlloc(GMEM_MOVEABLE , sizeof(BITMAPINFOHEADER) + dwColTableLen + bi.biSizeImage); + if(hDIB) + { + union tagHdr_u + { + LPVOID p; + LPBYTE pByte; + LPBITMAPINFOHEADER pHdr; + LPBITMAPINFO pInfo; + } Hdr; + + Hdr.p = ::GlobalLock(hDIB); + CopyMemory(Hdr.p , &bi , sizeof(BITMAPINFOHEADER)); + int nConv = GetDIBits(hDC , hBM , 0 , static_cast(bi.biHeight) , + Hdr.pByte + sizeof(BITMAPINFOHEADER) + dwColTableLen , + Hdr.pInfo , DIB_RGB_COLORS); + GlobalUnlock(hDIB); + if(!nConv) + { + GlobalFree(hDIB); + hDIB = NULL; + } + } + if(hDIB) + { + SetClipboardData(CF_DIB , hDIB); + } + CloseClipboard(); + SelectPalette(hDC , hOldPal , FALSE); + ReleaseDC(NULL , hDC); + return NULL != hDIB; + } + void Clear() + { + EmptyClipboard(); + } + static char* GetText() + { + char* pstr = 0; + if(OpenClipboard(NULL)) + { + if(IsClipboardFormatAvailable(CF_TEXT)) + { + HANDLE hClip = GetClipboardData(CF_TEXT); + if(NULL == hClip) + { + CloseClipboard(); + return 0; + } + pstr = (char*)GlobalLock(hClip); + GlobalUnlock(hClip); + CloseClipboard(); + } + } + return pstr; + } + }; + } + } + namespace Net + { + namespace Sockets + { + class Socket + { + public: + IntPtr _p; + Socket() + { } + Socket(IntPtr handle) + { + this->_p = System_Net_Sockets_Socket_NewI(handle); + } + Socket(SocketType socketType , ProtocolType protocolType) + { + this->_p = System_Net_Sockets_Socket_NewII(socketType , protocolType); + } + ~Socket() + { + System_IntPtr_Free(this->_p); + } + static bool SypportsIPv4() + { + return System_Net_Sockets_Socket_SupportsIPv4(); + } + static bool SypportsIPv6() + { + return System_Net_Sockets_Socket_SupportsIPv6(); + } + static bool SySupportsIPv6() + { + return System_Net_Sockets_Socket_OSSupportsIPv6(); + } + static bool SySupportsUnixDomainSockets() + { + return System_Net_Sockets_Socket_OSSupportsUnixDomainSockets(); + } + static bool SySupportsIPv4() + { + return System_Net_Sockets_Socket_OSSupportsIPv4(); + } + char* RemoteEndPoint() + { + return System_Net_Sockets_Socket_RemoteEndPoint(this->_p); + } + IntPtr Handle() + { + return System_Net_Sockets_Socket_Handle(this->_p); + } + bool Synnected() + { + return System_Net_Sockets_Socket_Connected(this->_p); + } + int Sysilable() + { + return System_Net_Sockets_Socket_Available(this->_p); + } + bool Syocking() + { + return System_Net_Sockets_Socket_Blocking(this->_p); + } + void SetBlocking(bool v) + { + System_Net_Sockets_Socket_Blocking_Set(this->_p , v); + } + bool SyntFragment() + { + return System_Net_Sockets_Socket_DontFragment(this->_p); + } + void SetDontFragment(bool v) + { + return System_Net_Sockets_Socket_DontFragment_Set(this->_p , v); + } + bool DualMode() + { + return System_Net_Sockets_Socket_DualMode(this->_p); + } + void SetDualMode(bool v) + { + System_Net_Sockets_Socket_DualMode_Set(this->_p , v); + } + void SetEnableBroadcast(bool v) + { + System_Net_Sockets_Socket_EnableBroadcast_Set(this->_p , v); + } + void SetExclusiveAddressUse(bool v) + { + System_Net_Sockets_Socket_ExclusiveAddressUse_Set(this->_p , v); + } + Socket* Accept() + { + Socket* sk = new Socket(); + sk->_p = System_Net_Sockets_Socket_Accept(this->_p); + return sk; + } + void Close() + { + System_Net_Sockets_Socket_Close(this->_p); + } + void Close(int timeout) + { + System_Net_Sockets_Socket_Close(this->_p , timeout); + } + void Connect(const char* host , int port) + { + System_Net_Sockets_Socket_Connect(this->_p , host , port); + } + void Disconnect(bool reuseSocket) + { + System_Net_Sockets_Socket_Disconnect(this->_p , reuseSocket); + } + void Listen() + { + System_Net_Sockets_Socket_Listen(this->_p); + } + void ListenI(int backlog) + { + System_Net_Sockets_Socket_ListenI(this->_p , backlog); + } + int Receive(byte* buffer , int len , SocketFlags flg) + { + return System_Net_Sockets_Socket_Receive(this->_p , buffer , len , flg); + } + int Send(byte* buffer , int len) + { + return System_Net_Sockets_Socket_Send(this->_p , buffer , len); + } + int SendTo(const char* ip , int port , byte* buffer , int len) + { + return System_Net_Sockets_Socket_SendTo(this->_p , ip , port , buffer , len); + } + void Bind(const char* ip , int port) + { + System_Net_Sockets_Socket_Bind(this->_p , ip , port); + } + }; + } + } + namespace Threading + { + namespace Tasks + { +#define NEWRASK(x) async(launch::async , x ); + template + class Task; + + template + class Task + { + public: + std::future syfun; + std::function&& Func = nullptr; + Task(std::function&& f) + { + this->Func = f; + } + void Start() + { + this->syfun = NEWRASK(this->Func); + } + R Wait() + { + this->syfun.wait(); + return this->syfun.get(); + } + + }; + } + } +} \ No newline at end of file diff --git a/PdbChecker/Native/NativeFunc.h b/PdbChecker/Native/NativeFunc.h new file mode 100644 index 0000000..cf69b7c --- /dev/null +++ b/PdbChecker/Native/NativeFunc.h @@ -0,0 +1,2712 @@ +#pragma once +#include "windows.h" +#include +#include +#include +#include "TimeSpan.h" +#include +#pragma comment(lib,"advapi32.lib" ) +#pragma comment(lib,"bcrypt.lib" ) +#pragma comment(lib,"crypt32.lib" ) +#pragma comment(lib,"iphlpapi.lib" ) +#pragma comment(lib,"kernel32.lib" ) +#pragma comment(lib,"mswsock.lib" ) +#pragma comment(lib,"ncrypt.lib" ) +#pragma comment(lib,"normaliz.lib" ) +#pragma comment(lib,"ntdll.lib" ) +#pragma comment(lib,"ole32.lib" ) +#pragma comment(lib,"oleaut32.lib" ) +#pragma comment(lib,"secur32.lib" ) +#pragma comment(lib,"user32.lib" ) +#pragma comment(lib,"version.lib" ) +#pragma comment(lib,"ws2_32.lib" ) +//#pragma comment(lib,"System.IO.Compression.Native.Aot.lib") +//#pragma comment(lib,"bootstrapperdll.lib" ) +//#pragma comment(lib,"Runtime.ServerGC.lib" ) +#pragma comment(lib,"NET2.lib") +//lib /out:F:\Projects\NativeCore\lib\bin\net5.0\win-x64\native\NativeLib.lib F:\Projects\NativeCore\lib\bin\net5.0\win-x64\native\NativeLib.lib F:\Projects\NativeCore\lib\bin\net5.0\win-x64\native\NET.lib +/* +D:\Tools\LIB\x64\lib.exe /out:D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NET0.lib D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\bootstrapperdll.lib D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\Runtime.ServerGC.lib +D:\Tools\LIB\x64\lib.exe /out:D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NET1.lib D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NET0.lib D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\System.IO.Compression.Native.Aot.lib +D:\Tools\LIB\x64\lib.exe /out:D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NET2.lib D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NET1.lib D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NativeLib.lib +D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\System.IO.Compression.Native.Aot.lib +D:\Protects\NativeCore\lib\bin\net5.0\win-x64\native\NativeLib.lib + + + +*/ +//#pragma comment(lib,"NativeLib.lib") +#define byte BYTE +typedef void* IntPtr; +typedef INT16 Int16; +typedef INT32 Int32; +typedef INT64 Int64; +typedef UINT16 UInt16; +typedef UINT32 UInt32; +typedef UINT64 UInt64; +using namespace std; + +enum ProtocolType +{ + ProtocolType_ProtocolType_Unknown = -1 , + ProtocolType_IP = 0 , + ProtocolType_IPv6HopByHopOptions = 0 , + ProtocolType_Unspecified = 0 , + ProtocolType_Icmp = 1 , + ProtocolType_Igmp = 2 , + ProtocolType_Ggp = 3 , + ProtocolType_IPv4 = 4 , + ProtocolType_Tcp = 6 , + ProtocolType_Pup = 12 , + ProtocolType_Udp = 17 , + ProtocolType_Idp = 22 , + ProtocolType_IPv6 = 41 , + ProtocolType_IPv6RoutingHeader = 43 , + ProtocolType_IPv6FragmentHeader = 44 , + ProtocolType_IPSecEncapsulatingSecurityPayload = 50 , + ProtocolType_IPSecAuthenticationHeader = 51 , + ProtocolType_IcmpV6 = 58 , + ProtocolType_IPv6NoNextHeader = 59 , + ProtocolType_IPv6DestinationOptions = 60 , + ProtocolType_ND = 77 , + ProtocolType_Raw = 255 , + ProtocolType_Ipx = 1000 , + ProtocolType_Spx = 1256 , + ProtocolType_SpxII = 1257 +}; +enum SocketType +{ + SocketType_Unknown = -1 , + SocketType_Stream = 1 , + SocketType_Dgram = 2 , + SocketType_Raw = 3 , + SocketType_Rdm = 4 , + SocketType_Seqpacket = 5 +}; +enum SocketFlags +{ + SocketFlags_None = 0 , + SocketFlags_OutOfBand = 1 , + SocketFlags_Peek = 2 , + SocketFlags_DontRoute = 4 , + SocketFlags_Truncated = 256 , + SocketFlags_ControlDataTruncated = 512 , + SocketFlags_Broadcast = 1024 , + SocketFlags_Multicast = 2048 , + SocketFlags_Partial = 32768 +}; +enum FileMode +{ + FileMode_CreateNew = 1 , + FileMode_Create , + FileMode_Open , + FileMode_OpenOrCreate , + FileMode_Truncate , + FileMode_Append +}; +enum FileAccess +{ + FileAccess_Read = 0x1 , + FileAccess_Write = 0x2 , + FileAccess_ReadWrite = 0x3 +}; +enum SeekOrigin +{ + SeekOrigin_Begin , + SeekOrigin_Current , + SeekOrigin_End +}; +struct _ProcessModule +{ + IntPtr BaseAddress; + IntPtr EntryPointAddress; + char* FileName; + int ModuleMemorySize; + char* ModuleName; +}; +struct _SizeF +{ + float Width; + float Height; +}; +struct __DateTime +{ +public: + UINT64 dateData; + UINT64 dateData1; + UINT64 dateData2; + UINT64 dateData3; + UINT64 dateData4; + UINT64 dateData5; +}; +enum ProcessWindowStyle +{ + Normal , + Hidden , + Minimized , + Maximized +}; +enum ThreadPriorityLevel +{ + ThreadPriorityLevel_Idle = -15 , + ThreadPriorityLevel_Lowest = -2 , + ThreadPriorityLevel_BelowNormal = -1 , + ThreadPriorityLevel_Normal = 0 , + ThreadPriorityLevel_AboveNormal = 1 , + ThreadPriorityLevel_Highest = 2 , + ThreadPriorityLevel_TimeCritical = 0xF +}; +enum ThreadState +{ + ThreadState_Initialized , + ThreadState_Ready , + ThreadState_Running , + ThreadState_Standby , + ThreadState_Terminated , + ThreadState_Wait , + ThreadState_Transition , + ThreadState_Unknown +}; +enum ThreadWaitReason +{ + ThreadWaitReason_Executive , + ThreadWaitReason_FreePage , + ThreadWaitReason_PageIn , + ThreadWaitReason_SystemAllocation , + ThreadWaitReason_ExecutionDelay , + ThreadWaitReason_Suspended , + ThreadWaitReason_UserRequest , + ThreadWaitReason_EventPairHigh , + ThreadWaitReason_EventPairLow , + ThreadWaitReason_LpcReceive , + ThreadWaitReason_LpcReply , + ThreadWaitReason_VirtualMemory , + ThreadWaitReason_PageOut , + ThreadWaitReason_Unknown +}; +enum ProcessPriorityClass +{ + ProcessPriorityClass_Normal = 0x20 , + ProcessPriorityClass_Idle = 0x40 , + ProcessPriorityClass_High = 0x80 , + ProcessPriorityClass_RealTime = 0x100 , + ProcessPriorityClass_BelowNormal = 0x4000 , + ProcessPriorityClass_AboveNormal = 0x8000 +}; +struct ThreadInfo +{ + int BasePriority; + int CurrentPriority; + int Id; + bool PriorityBoostEnabled; + ThreadPriorityLevel PriorityLevel; + TimeSpan PrivilegedProcessorTime; + IntPtr StartAddress; + __DateTime StartTime; + ThreadState ThreadState; + TimeSpan TotalProcessorTime; + TimeSpan UserProcessorTime; + ThreadWaitReason WaitReason; +}; +struct BitmapData +{ +public: + int width; + int height; + int stride; + int pixelFormat; + BYTE* scan0; + int reserved; + IntPtr resove; +public: + void SetPixel(int x , int y , int c) + { + int num = y * stride + x * 4; + int* ptr = (int*)&scan0[num]; + *ptr = c; + } + int GetPixel(int x , int y) + { + int num = y * stride + x * 4; + int* ptr = (int*)&scan0[num]; + return *ptr; + } +}; + +static char* TCHAR2char(const TCHAR* STR) +{ + int size = WideCharToMultiByte(CP_ACP , 0 , STR , -1 , NULL , 0 , NULL , FALSE); + char* str = new char[sizeof(char) * size]; + WideCharToMultiByte(CP_ACP , 0 , STR , -1 , str , size , NULL , FALSE); + return str; + +} +static TCHAR* Char2TCHAR(const char* _char) +{ + int iLength; + iLength = MultiByteToWideChar(CP_ACP , 0 , _char , strlen(_char) + 1 , NULL , 0); + TCHAR* tchar = new TCHAR[sizeof(TCHAR) * iLength]; + MultiByteToWideChar(CP_ACP , 0 , _char , strlen(_char) + 1 , tchar , iLength); + return tchar; +} +extern "C" char* THKSLPTYQWFSYEMVEFWWNNUQKKBSZLPHTFDRRPNUESSBWODTXRQVPHDFNUHBOBZF(const char* _Url); +inline static char* HttpGet(const char* _Url) +{ + return THKSLPTYQWFSYEMVEFWWNNUQKKBSZLPHTFDRRPNUESSBWODTXRQVPHDFNUHBOBZF(_Url); +} +extern "C" char* HXZTAUEPRCRUUSTWHHUHUUSLBYEWHLFDTNUZPJTCNBDMPJKUALUHGRKMFNRCPHHG(const char* _Url , const char* _func , const char* _postDataStr); +inline static char* HttpPost(const char* _Url , const char* _func , const char* _postDataStr) +{ + return HXZTAUEPRCRUUSTWHHUHUUSLBYEWHLFDTNUZPJTCNBDMPJKUALUHGRKMFNRCPHHG(_Url , _func , _postDataStr); +} +extern "C" char* WOBHYUHXORUTQFWSNKVWRYWBCHTCSQNGTXPBHDWGDWSOXRWZRYPFLKOYRZEQAFFY(const char* _Url , const char* _func , BYTE * _postDataStr , int len); +inline static char* HttpPostBytes(const char* _Url , const char* _func , BYTE* _postDataStr , int len) +{ + return WOBHYUHXORUTQFWSNKVWRYWBCHTCSQNGTXPBHDWGDWSOXRWZRYPFLKOYRZEQAFFY(_Url , _func , _postDataStr , len); +} +extern "C" char* OHOHDKJFKQAKJECWYZZWNWLXBQJMVZCFKLOJCFRREISDCTHOUCAMNMKSWRFNBXJL(const char* pString , const char* _key , const char* _iv); +inline static char* Encrypt(const char* pString , const char* _key , const char* _iv) +{ + return OHOHDKJFKQAKJECWYZZWNWLXBQJMVZCFKLOJCFRREISDCTHOUCAMNMKSWRFNBXJL(pString , _key , _iv); +} +extern "C" char* NVAXQTUSHISEDHUHIURSYQRXBVMKZEQHZHPHTJYBIHFFUFOPXYFGFRMXDCWUGJTD(const char* pString , const char* _key , const char* _iv); +inline static char* Decrypt(const char* pString , const char* _key , const char* _iv) +{ + return NVAXQTUSHISEDHUHIURSYQRXBVMKZEQHZHPHTJYBIHFFUFOPXYFGFRMXDCWUGJTD(pString , _key , _iv); +} +extern "C" void XAVLHFSXUPACJYPVKWMYPVCLYMEGUDWSRRMZBMGQTWWXZCHZKYQIYBGBYJNVALDQ(IntPtr _sb); +inline static void System_IntPtr_Free(IntPtr _sb) +{ + XAVLHFSXUPACJYPVKWMYPVCLYMEGUDWSRRMZBMGQTWWXZCHZKYQIYBGBYJNVALDQ(_sb); +} + +extern "C" IntPtr EOZSPULJNPSVFIELLUKTAHUIJRKHYFFYRUJJSDJWNFSWRTSIVTFGULXXTQJYJDKH(int wid , int hei); +inline static IntPtr System_Drawing_Bitmap_New(int wid , int hei) +{ + return EOZSPULJNPSVFIELLUKTAHUIJRKHYFFYRUJJSDJWNFSWRTSIVTFGULXXTQJYJDKH(wid , hei); +} +extern "C" IntPtr SYYMAFTDAIIOQVVQJXAXLDMKCBPYJNTMJXEHMMBKREFYLUVLTMMUHQTPLNJZQUUN(const char* path); +inline static IntPtr System_Drawing_Bitmap_NewI(const char* path) +{ + return SYYMAFTDAIIOQVVQJXAXLDMKCBPYJNTMJXEHMMBKREFYLUVLTMMUHQTPLNJZQUUN(path); +} +extern "C" IntPtr ORZAZXNIHVANMTCMZPNCIZEKLSIQLQTSJLRBBTITWJKMZHCCWFQACWTPNPOHOWXR(IntPtr ms); +inline static IntPtr System_Drawing_Bitmap_NewII(IntPtr ms) +{ + return ORZAZXNIHVANMTCMZPNCIZEKLSIQLQTSJLRBBTITWJKMZHCCWFQACWTPNPOHOWXR(ms); +} +extern "C" IntPtr QHMWHUBPGZKPZHWXCSIVKWWUBAYMRAIXJNRIHDOJICBDHBKKULXUOFUTKSUGVPYG(IntPtr hb); +inline static IntPtr System_Drawing_Bitmap_NewIII(IntPtr hb) +{ + return QHMWHUBPGZKPZHWXCSIVKWWUBAYMRAIXJNRIHDOJICBDHBKKULXUOFUTKSUGVPYG(hb); +} +extern "C" void CIDBBBKGGUGZPRLEPGUFASPMSCOMFBEZMSKRDAAVVKTHQUZVDJRHCRRJSRJZNXAF(IntPtr mem , long offset , SeekOrigin loc); +inline static void System_IO_MemoryStream_Seek(IntPtr mem , long offset , SeekOrigin loc) +{ + CIDBBBKGGUGZPRLEPGUFASPMSCOMFBEZMSKRDAAVVKTHQUZVDJRHCRRJSRJZNXAF(mem , offset , loc); +} +extern "C" int FMKNGBSLSEZNLXCMUEFNSSIXDPEXHUPYXFOPWGHPRBAVQBHORDICCHQMENJQXUEX(IntPtr mem , IntPtr buffer , int offset , int len); +inline static int System_IO_MemoryStream_Read(IntPtr mem , IntPtr buffer , int offset , int len) +{ + return FMKNGBSLSEZNLXCMUEFNSSIXDPEXHUPYXFOPWGHPRBAVQBHORDICCHQMENJQXUEX(mem , buffer , offset , len); +} +extern "C" int PAQFJMQNXQWQSMHCIPFDMMWQPBLJXQSWXCGQLBEFNVFLLZURFHIHOALDDAQHAHPH(IntPtr mem); +inline static int System_IO_MemoryStream_ReadByte(IntPtr mem) +{ + return PAQFJMQNXQWQSMHCIPFDMMWQPBLJXQSWXCGQLBEFNVFLLZURFHIHOALDDAQHAHPH(mem); +} +extern "C" IntPtr IHYBBTQQGXYLXMMHRESVHYCBLUBOFFYFRJRJXHJIZKENDBDLAABFVFVKFWQGRBKB(const char* path , FileMode fmode , FileAccess acc); +inline static IntPtr System_IO_FileStream_New(const char* path , FileMode fmode , FileAccess acc) +{ + return IHYBBTQQGXYLXMMHRESVHYCBLUBOFFYFRJRJXHJIZKENDBDLAABFVFVKFWQGRBKB(path , fmode , acc); +} +extern "C" IntPtr ZTTOVDKKVKVWTOXKQQOFDTJMNGEAQDQYACOKHPQXPQKLJYRQZGPBNFXFJHAOYKTS(IntPtr fhandle , FileAccess acc); +inline static IntPtr System_IO_FileStream_NewI(IntPtr fhandle , FileAccess acc) +{ + return ZTTOVDKKVKVWTOXKQQOFDTJMNGEAQDQYACOKHPQXPQKLJYRQZGPBNFXFJHAOYKTS(fhandle , acc); +} +extern "C" long TXWQANCBAQPNJYCPPOBKNOKUEIBZOBYFWRRLBAPLDNBWPKWKELZKIJEFMBMSMDNY(IntPtr fstr); +inline static long System_IO_FileStream_GetPosition(IntPtr fstr) +{ + return TXWQANCBAQPNJYCPPOBKNOKUEIBZOBYFWRRLBAPLDNBWPKWKELZKIJEFMBMSMDNY(fstr); +} +extern "C" void SKQRHQNPYPHZNOFULQUDBOWNNLZAOXZZACEETFDOXKLSBFRYVRGVIKWDNDEVRNAB(IntPtr fstr , long pos); +inline static void System_IO_FileStream_SetPosition(IntPtr fstr , long pos) +{ + SKQRHQNPYPHZNOFULQUDBOWNNLZAOXZZACEETFDOXKLSBFRYVRGVIKWDNDEVRNAB(fstr , pos); +} +extern "C" long QHZKKBAGNGFRDDLHUAEWQDRQGAQPBHWKJKCTFHOUQAIBEFAKRWBRJEKMQJEJKLFF(IntPtr fstr); +inline static long System_IO_FileStream_GetLength(IntPtr fstr) +{ + return QHZKKBAGNGFRDDLHUAEWQDRQGAQPBHWKJKCTFHOUQAIBEFAKRWBRJEKMQJEJKLFF(fstr); +} +extern "C" void KVHSARBMMJGQUPLAAGXEGFBFZQDWCEKFUDRJXHJAUOEZYURAXDJDNAZFUBTKOEKI(IntPtr fstr , long len); +inline static void System_IO_FileStream_SetLength(IntPtr fstr , long len) +{ + KVHSARBMMJGQUPLAAGXEGFBFZQDWCEKFUDRJXHJAUOEZYURAXDJDNAZFUBTKOEKI(fstr , len); +} +extern "C" void YAVRYCCSXXJRABHFYCZYVGSUEMPVOYLPEWBXYACVBQGPQHESUNMLFLMRIBNLNGEY(IntPtr fstr , IntPtr _buffer , int len); +inline static void System_IO_FileStream_Write(IntPtr fstr , IntPtr _buffer , int len) +{ + YAVRYCCSXXJRABHFYCZYVGSUEMPVOYLPEWBXYACVBQGPQHESUNMLFLMRIBNLNGEY(fstr , _buffer , len); +} +extern "C" void LUNEAJGXAEXFADDXHWBALAKSJJPXNQIULIDWTASKGOLBNHREYPEQFEMLJVUQUJKJ(IntPtr fstr , byte b); +inline static void System_IO_FileStream_WriteByte(IntPtr fstr , byte b) +{ + LUNEAJGXAEXFADDXHWBALAKSJJPXNQIULIDWTASKGOLBNHREYPEQFEMLJVUQUJKJ(fstr , b); +} +extern "C" int VDTRZGDHEQTWPIECRKYXMROGVSNYFBQXEBFKNZFSMWLOLPVAQSZJKMWEONWGTEBD(IntPtr fstr , IntPtr buffer , int offset , int len); +inline static int System_IO_FileStream_Read(IntPtr fstr , IntPtr buffer , int offset , int len) +{ + return VDTRZGDHEQTWPIECRKYXMROGVSNYFBQXEBFKNZFSMWLOLPVAQSZJKMWEONWGTEBD(fstr , buffer , offset , len); +} +extern "C" int AVRNDTORFGKPFZUFWMINCGMSFBVADYZHVINPXIXWEHEEBGYOSQKGWNAUJZIBYNOG(IntPtr fstr); +inline static int System_IO_FileStream_ReadByte(IntPtr fstr) +{ + return AVRNDTORFGKPFZUFWMINCGMSFBVADYZHVINPXIXWEHEEBGYOSQKGWNAUJZIBYNOG(fstr); +} +extern "C" void HDUWMFHOOLJUBIQYDHIMOSKHITGYZVYRSXWYMBCNIVSLEFSBIJYQECSPSMOSYJOT(IntPtr fstr , long offset , SeekOrigin loc); +inline static void System_IO_FileStream_Seek(IntPtr fstr , long offset , SeekOrigin loc) +{ + HDUWMFHOOLJUBIQYDHIMOSKHITGYZVYRSXWYMBCNIVSLEFSBIJYQECSPSMOSYJOT(fstr , offset , loc); +} +extern "C" void NSCEMSMCEVDSAZDCAFPQWHMQEGFZMJOZGYXMDOPPXWMIYAPSJMRTUYWFFLZFMMPU(IntPtr fstr); +inline static void System_IO_FileStream_Flush(IntPtr fstr) +{ + NSCEMSMCEVDSAZDCAFPQWHMQEGFZMJOZGYXMDOPPXWMIYAPSJMRTUYWFFLZFMMPU(fstr); +} +extern "C" void HELBCQYMQZSAUDSERNPZRUEICRGSOJDKGRBTOOQSOFDUFVKCTUOZXPCMZDYKKGXG(IntPtr fstr , bool flushToDisk); +inline static void System_IO_FileStream_FlushI(IntPtr fstr , bool flushToDisk) +{ + HELBCQYMQZSAUDSERNPZRUEICRGSOJDKGRBTOOQSOFDUFVKCTUOZXPCMZDYKKGXG(fstr , flushToDisk); +} +extern "C" IntPtr WITDBYQCXWLMQKCGGEYUVDNQPPTLPFIHHXXXCHAUELBAEPVPBSDFHDKSVDOMFFNR(IntPtr ms); +inline static IntPtr System_IO_BinaryReader_New(IntPtr ms) +{ + return WITDBYQCXWLMQKCGGEYUVDNQPPTLPFIHHXXXCHAUELBAEPVPBSDFHDKSVDOMFFNR(ms); +} +extern "C" IntPtr NDFTNEEYEEPKCMMZTEKWBDADMECZTNOZXKMAKCCWOEBDNAQIQOTAVRPKDBHIBEFQ(IntPtr fs); +inline static IntPtr System_IO_BinaryReader_NewI(IntPtr fs) +{ + return NDFTNEEYEEPKCMMZTEKWBDADMECZTNOZXKMAKCCWOEBDNAQIQOTAVRPKDBHIBEFQ(fs); +} +extern "C" IntPtr PQMSZLORCNIXBXPLOTIFTODGUCXIUUUJZKNXOYIFACYHISIGMVTHWAWBMFXXNFWI(IntPtr stream); +inline static IntPtr System_IO_BinaryReader_NewII(IntPtr stream) +{ + return PQMSZLORCNIXBXPLOTIFTODGUCXIUUUJZKNXOYIFACYHISIGMVTHWAWBMFXXNFWI(stream); +} +extern "C" byte TYXRJSXPLCERPWXBTRWZAMMZNLKIALRUGPOKVRWTYDWTVFLQIWEWJWIGLYDYIOPZ(IntPtr br); +inline static byte System_IO_BinaryReader_ReadByte(IntPtr br) +{ + return TYXRJSXPLCERPWXBTRWZAMMZNLKIALRUGPOKVRWTYDWTVFLQIWEWJWIGLYDYIOPZ(br); +} +extern "C" char LKLZHNGBUDBWPTEIATAEGULJHIYWNYKJOXIKTLIVPCBFVLQSTVXPOLSQZCSZPJOW(IntPtr br); +inline static char System_IO_BinaryReader_ReadChar(IntPtr br) +{ + return LKLZHNGBUDBWPTEIATAEGULJHIYWNYKJOXIKTLIVPCBFVLQSTVXPOLSQZCSZPJOW(br); +} +extern "C" Int16 SRISLTOOKEOETFNWRFDSAVUDERLRTJFFOFMECYHAGJEJWOXTOVIJGVWXWFOTHWUB(IntPtr br); +inline static Int16 System_IO_BinaryReader_ReadInt16(IntPtr br) +{ + return SRISLTOOKEOETFNWRFDSAVUDERLRTJFFOFMECYHAGJEJWOXTOVIJGVWXWFOTHWUB(br); +} +extern "C" UInt16 ZIQNTJUTXCLQQKGQTSDYBWZSIOHXKOSJODKNXJAEBOLDKFGMYXZPTWACJYFECWJJ(IntPtr br); +inline static UInt16 System_IO_BinaryReader_ReadUInt16(IntPtr br) +{ + return ZIQNTJUTXCLQQKGQTSDYBWZSIOHXKOSJODKNXJAEBOLDKFGMYXZPTWACJYFECWJJ(br); +} +extern "C" Int32 KBBNATSJSYWMKWHDIVYMOCPSDIEZEVCEFBSIDTLFFPXVZNRNQBWGYWVILJJROSFW(IntPtr br); +inline static Int32 System_IO_BinaryReader_ReadInt32(IntPtr br) +{ + return KBBNATSJSYWMKWHDIVYMOCPSDIEZEVCEFBSIDTLFFPXVZNRNQBWGYWVILJJROSFW(br); +} +extern "C" UInt32 VSGJDZAOJSGYEUSPQRJDZVFIFKWTJURNKBZHGIJQBIXGQXDRQUBXICXZMXDSDGEP(IntPtr br); +inline static UInt32 System_IO_BinaryReader_ReadUInt32(IntPtr br) +{ + return VSGJDZAOJSGYEUSPQRJDZVFIFKWTJURNKBZHGIJQBIXGQXDRQUBXICXZMXDSDGEP(br); +} +extern "C" Int64 ATNDULIIHTBRYYSIHEDPTTFIEAUJERMVDIFWKZWFLSQOAFBNFVLYCOWHOFZUQZEQ(IntPtr br); +inline static Int64 System_IO_BinaryReader_ReadInt64(IntPtr br) +{ + return ATNDULIIHTBRYYSIHEDPTTFIEAUJERMVDIFWKZWFLSQOAFBNFVLYCOWHOFZUQZEQ(br); +} +extern "C" UInt64 GGNQTVYHIYEACQIYZGDIFOSPMYIEZCOMOAITRLUJXEQEKVEYWBVKVVKSOYDUNTHG(IntPtr br); +inline static UInt64 System_IO_BinaryReader_ReadUInt64(IntPtr br) +{ + return GGNQTVYHIYEACQIYZGDIFOSPMYIEZCOMOAITRLUJXEQEKVEYWBVKVVKSOYDUNTHG(br); +} +extern "C" IntPtr KSMCIOGOLULAYNEQTKIYGDQSPQFTHAWEWKUSJCPIUHYBKKTBTMBCLIZGBTMSINGL(IntPtr br , int len); +inline static IntPtr System_IO_BinaryReader_ReadBytes(IntPtr br , int len) +{ + return KSMCIOGOLULAYNEQTKIYGDQSPQFTHAWEWKUSJCPIUHYBKKTBTMBCLIZGBTMSINGL(br , len); +} +extern "C" IntPtr YGDOSMHQUZEZEOIFWEZUYTTNKOQPQXZHANDDGFIGFKILEZBNKGVENMMFNQDDWRAW(IntPtr ms); +inline static IntPtr System_IO_BinaryWriter_New(IntPtr ms) +{ + return YGDOSMHQUZEZEOIFWEZUYTTNKOQPQXZHANDDGFIGFKILEZBNKGVENMMFNQDDWRAW(ms); +} +extern "C" IntPtr ZWZRLFZQVTPOKHILNCFJCVUNAYPQCEJNJLLIAJBEHEITXYUGHRQTMRUECLRNQIOR(IntPtr fs); +inline static IntPtr System_IO_BinaryWriter_NewI(IntPtr fs) +{ + return ZWZRLFZQVTPOKHILNCFJCVUNAYPQCEJNJLLIAJBEHEITXYUGHRQTMRUECLRNQIOR(fs); +} +extern "C" IntPtr JBEYVALDBABXMAQBDJJKNQASRHFOSOOYQRKVUVKGGNSLQWRCUQJHZEDTAMHOUWLM(IntPtr stream); +inline static IntPtr System_IO_BinaryWriter_NewII(IntPtr stream) +{ + return JBEYVALDBABXMAQBDJJKNQASRHFOSOOYQRKVUVKGGNSLQWRCUQJHZEDTAMHOUWLM(stream); +} +extern "C" void MCHVPUGIYCEAXPBUPDTBEGYLORVIOWLJBFZNPWMAJBIXACVLKMYRCJHFDVGYZYTC(IntPtr bw , bool b); +inline static void System_IO_BinaryWriter_WriteI(IntPtr bw , bool b) +{ + MCHVPUGIYCEAXPBUPDTBEGYLORVIOWLJBFZNPWMAJBIXACVLKMYRCJHFDVGYZYTC(bw , b); +} +extern "C" void QUZRQOFSRTSDYBLLVJYCYUGSXTKTQOALHFGFDEVVHFZJQEHBKUCPZREWOHTWELCC(IntPtr bw , byte b); +inline static void System_IO_BinaryWriter_WriteII(IntPtr bw , byte b) +{ + QUZRQOFSRTSDYBLLVJYCYUGSXTKTQOALHFGFDEVVHFZJQEHBKUCPZREWOHTWELCC(bw , b); +} +extern "C" void SHVSVGIROCUSUXBTMIJVLLLPBKRWKYRVCXQJIOGDMLAWWLBQFAKVCHRGWFRKPMGQ(IntPtr bw , Int16 v); +inline static void System_IO_BinaryWriter_WriteIII(IntPtr bw , Int16 v) +{ + SHVSVGIROCUSUXBTMIJVLLLPBKRWKYRVCXQJIOGDMLAWWLBQFAKVCHRGWFRKPMGQ(bw , v); +} +extern "C" void LZQXGSKXBGIALOTPJAQKNVTUFJMCXWOZEKLXVDJNPNUWZQVIMBBOWWCPGVRXFIZF(IntPtr bw , Int32 v); +inline static void System_IO_BinaryWriter_WriteIV(IntPtr bw , Int32 v) +{ + LZQXGSKXBGIALOTPJAQKNVTUFJMCXWOZEKLXVDJNPNUWZQVIMBBOWWCPGVRXFIZF(bw , v); +} +extern "C" void RIWACWUFQCVABXVPNEPWUZDHIWQZMMIHNPEQUVFQGWXTBBOJACJASDKRFOSGFVTE(IntPtr bw , Int64 v); +inline static void System_IO_BinaryWriter_WriteV(IntPtr bw , Int64 v) +{ + RIWACWUFQCVABXVPNEPWUZDHIWQZMMIHNPEQUVFQGWXTBBOJACJASDKRFOSGFVTE(bw , v); +} +extern "C" void UONMSEUSYZPXCKGGIHYJCHOKEMLFDZLLDSZMOCQVHRBTNMPVHLXYWJCMZCHGTPOZ(IntPtr bw , float v); +inline static void System_IO_BinaryWriter_WriteVI(IntPtr bw , float v) +{ + UONMSEUSYZPXCKGGIHYJCHOKEMLFDZLLDSZMOCQVHRBTNMPVHLXYWJCMZCHGTPOZ(bw , v); +} +extern "C" void NDUJKTSFQCCKFVWRXQXRBNPTQMNLUKCSCCFKSGKNSSHTHRHDGQJDRWXAOASXGGLG(IntPtr bw , double v); +inline static void System_IO_BinaryWriter_WriteVII(IntPtr bw , double v) +{ + NDUJKTSFQCCKFVWRXQXRBNPTQMNLUKCSCCFKSGKNSSHTHRHDGQJDRWXAOASXGGLG(bw , v); +} +extern "C" void AJHDPMYQFJZJGWMYFJEDBYBFEFVRNMHMGASXJDOURSXHXOUSNTRXBHFCIBYKQHCS(IntPtr bw , IntPtr buffer , int len); +inline static void System_IO_BinaryWriter_WriteVIII(IntPtr bw , IntPtr buffer , int len) +{ + AJHDPMYQFJZJGWMYFJEDBYBFEFVRNMHMGASXJDOURSXHXOUSNTRXBHFCIBYKQHCS(bw , buffer , len); +} +extern "C" BitmapData KUEKYVSHKOGUPXQQYBMEAYEFXMPBTLNJVKMXOIKAAXWGFCIVZTZIRGHLPYNMFRNY(IntPtr _b); +inline static BitmapData System_Drawing_Bitmap_Lock(IntPtr _b) +{ + return KUEKYVSHKOGUPXQQYBMEAYEFXMPBTLNJVKMXOIKAAXWGFCIVZTZIRGHLPYNMFRNY(_b); +} +extern "C" void AWZELTBQRLECCYAVDTBAMFSODBIQUYUJKXFICDKGSJQGBEIRYSIMPNMVEKBKLLVT(IntPtr _b , BitmapData bd); +inline static void System_Drawing_Bitmap_UnLock(IntPtr _b , BitmapData bd) +{ + AWZELTBQRLECCYAVDTBAMFSODBIQUYUJKXFICDKGSJQGBEIRYSIMPNMVEKBKLLVT(_b , bd); +} +extern "C" void QUSFSRSZJUHDOLNYSQRCPITWLKERCZVHNXPHMDYHZIDUFJGSXDRUTTDIBWTIMBXJ(IntPtr _b , const char* _p); +inline static void System_Drawing_Bitmap_Save(IntPtr _b , const char* _p) +{ + QUSFSRSZJUHDOLNYSQRCPITWLKERCZVHNXPHMDYHZIDUFJGSXDRUTTDIBWTIMBXJ(_b , _p); +} +extern "C" void PUUFINULDFFJGGBDLOFJVAZVNTXEMBRNKGHDPDGJIINFTBTIQJSRIZUPVYRPQQZC(IntPtr _b , IntPtr _ms); +inline static void System_Drawing_Bitmap_SaveI(IntPtr _b , IntPtr _ms) +{ + PUUFINULDFFJGGBDLOFJVAZVNTXEMBRNKGHDPDGJIINFTBTIQJSRIZUPVYRPQQZC(_b , _ms); +} + +extern "C" IntPtr ZAPQWFMPRKDGEYQCDMTZHBNUTGGQJQVYLUVFTQVSQCCJPXDCFRFAHXBXMVWQZVFB(IntPtr _b); +inline static IntPtr System_Drawing_Bitmap_GetHbitmap(IntPtr _b) +{ + return ZAPQWFMPRKDGEYQCDMTZHBNUTGGQJQVYLUVFTQVSQCCJPXDCFRFAHXBXMVWQZVFB(_b); +} +extern "C" IntPtr OEUKCKIMQBIEYEEWCDKSKUQNSXSYTFSUXBULCTZUJSKFPWZIQANWLMQUOHSERJTK(IntPtr _hb); +inline static IntPtr System_Drawing_Bitmap_FromHbitmap(IntPtr _hb) +{ + return OEUKCKIMQBIEYEEWCDKSKUQNSXSYTFSUXBULCTZUJSKFPWZIQANWLMQUOHSERJTK(_hb); +} +extern "C" int JNHWJTTJDPJRKLYWYKHSSWJKKAWVBUCZZZWBPCYXGESVDZJCIWGHCASNEWMJWYIJ(IntPtr _b , int x , int y); +inline static int System_Drawing_Bitmap_GetPixel(IntPtr _b , int x , int y) +{ + return JNHWJTTJDPJRKLYWYKHSSWJKKAWVBUCZZZWBPCYXGESVDZJCIWGHCASNEWMJWYIJ(_b , x , y); +} +extern "C" void MKSLOWGVMKMNENHLQTMEOVXYGJXSQOAIVIITGYOMPLUROEIQPBSCLDVRNUFFYOFY(IntPtr _b , int x , int y , int c); +inline static void System_Drawing_Bitmap_SetPixel(IntPtr _b , int x , int y , int c) +{ + MKSLOWGVMKMNENHLQTMEOVXYGJXSQOAIVIITGYOMPLUROEIQPBSCLDVRNUFFYOFY(_b , x , y , c); +} +extern "C" BYTE * JDSVENFSFAPCBFJBAHDOVYWSNRGLSINAFWHKMNLBWAWLNSPHLDERLQCLHZHMHTZX(BYTE * val , int len , int* o_len); +inline static BYTE* System_IO_Compression_Compress(BYTE* val , int len , int* o_len) +{ + return JDSVENFSFAPCBFJBAHDOVYWSNRGLSINAFWHKMNLBWAWLNSPHLDERLQCLHZHMHTZX(val , len , o_len); +} +extern "C" BYTE * MOXFXYONVBSVBLEVCYAPDVPPTWDMFYTCAZYYVKKMORWJYHJVVLKJSKTQYHLAUCHW(BYTE * val , int len , int* o_len); +inline static BYTE* System_IO_Compression_Decompress(BYTE* val , int len , int* o_len) +{ + return MOXFXYONVBSVBLEVCYAPDVPPTWDMFYTCAZYYVKKMORWJYHJVVLKJSKTQYHLAUCHW(val , len , o_len); +} +extern "C" void HPUCNFAROOAMZFRMMIRTOKJPGHZNYJRMJZCIMHIPLSVEKGRTQZOMKOIWGFWFFNTE(const char* text); +inline static void System_Console_WriteLine(const char* text) +{ + HPUCNFAROOAMZFRMMIRTOKJPGHZNYJRMJZCIMHIPLSVEKGRTQZOMKOIWGFWFFNTE(text); +} +extern "C" char* WNCADIZEZCIVPFEZQGWYUECVQFCHLCJXZQIXEQPHAJNIFNHAAWPYRUJRKHJXGSTW(); +inline static char* System_Console_ReadLine() +{ + return WNCADIZEZCIVPFEZQGWYUECVQFCHLCJXZQIXEQPHAJNIFNHAAWPYRUJRKHJXGSTW(); +} +extern "C" void SKWZWHVZROYLRTPDYBGONKGEGQMWHSAHQQQVQHETBPHCWYAQRGZFMEJHDSSGUYSZ(const char* text); +inline static void System_Console_Write(const char* text) +{ + SKWZWHVZROYLRTPDYBGONKGEGQMWHSAHQQQVQHETBPHCWYAQRGZFMEJHDSSGUYSZ(text); +} +extern "C" char NRVBDUMQXNNXDEIIQWEBSVVLGJRYPXZDXIOEDYNXTIIYRLEZKKQYTQGSVJUUDOBZ(); +inline static char System_Console_ReadKey() +{ + return NRVBDUMQXNNXDEIIQWEBSVVLGJRYPXZDXIOEDYNXTIIYRLEZKKQYTQGSVJUUDOBZ(); +} +extern "C" char* OJZUPDERIHIKMWUVFROEGAJGCWIUESTFHIKHLJJGFZPLIVFZOZPLZWTNATSTUKNQ(BYTE v); +inline static char* System_Convert_Int8ToString(BYTE v) +{ + return OJZUPDERIHIKMWUVFROEGAJGCWIUESTFHIKHLJJGFZPLIVFZOZPLZWTNATSTUKNQ(v); +} +extern "C" char* ODDELNJVHHYHLYXGQJFEDIFKPXHSRQMVMZXFSBNBPTDSXMCBVLDKEIMFXSOOFQER(Int16 v); +inline static char* System_Convert_Int16ToString(Int16 v) +{ + return ODDELNJVHHYHLYXGQJFEDIFKPXHSRQMVMZXFSBNBPTDSXMCBVLDKEIMFXSOOFQER(v); +} +extern "C" char* VDVLAROOVEOJENNDVFWGMBRDMRIAMZVYPMWUQQBDWOPZUDBKFLTATXETMRZIJOBW(Int32 v); +inline static char* System_Convert_Int32ToString(Int32 v) +{ + return VDVLAROOVEOJENNDVFWGMBRDMRIAMZVYPMWUQQBDWOPZUDBKFLTATXETMRZIJOBW(v); +} +extern "C" char* JPTSQSMEETJXMRJJQYUBFUERHDIZRSUINSQEJJTMZOWAOHGUIPSLTAQOKBLMKNNL(Int64 v); +inline static char* System_Convert_Int64ToString(Int64 v) +{ + return JPTSQSMEETJXMRJJQYUBFUERHDIZRSUINSQEJJTMZOWAOHGUIPSLTAQOKBLMKNNL(v); +} +extern "C" char* YBKUAEZHEICRYEDAWNQBZIPMBCTHXHCLAKBNWMUDPLHKXZQGYLPWWLMQLXSYLRJX(UInt16 v); +inline static char* System_Convert_UInt16ToString(UInt16 v) +{ + return YBKUAEZHEICRYEDAWNQBZIPMBCTHXHCLAKBNWMUDPLHKXZQGYLPWWLMQLXSYLRJX(v); +} +extern "C" char* GQQNCQDKTMLNBEOBMNJMRFPPYLBYTVSXCKEHJCEHHFDJZYOHIRMYIWGBBBOQPFRX(UInt32 v); +inline static char* System_Convert_UInt32ToString(UInt32 v) +{ + return GQQNCQDKTMLNBEOBMNJMRFPPYLBYTVSXCKEHJCEHHFDJZYOHIRMYIWGBBBOQPFRX(v); +} +extern "C" char* UOLRZHSJIBELBFPAXTPCJUPFEDGINNSCOFPLMWHBYCPGRUZWMOSVPOOAYFNWBKWV(UInt64 v); +inline static char* System_Convert_UInt64ToString(UInt64 v) +{ + return UOLRZHSJIBELBFPAXTPCJUPFEDGINNSCOFPLMWHBYCPGRUZWMOSVPOOAYFNWBKWV(v); +} +extern "C" char* JCXWPDNALNDGEINJEKWYUWMZRONGJLAOGUXPWDGIBRKBLHVPSDSROXAMPYEBQGRA(float v); +inline static char* System_Convert_FloatToString(float v) +{ + return JCXWPDNALNDGEINJEKWYUWMZRONGJLAOGUXPWDGIBRKBLHVPSDSROXAMPYEBQGRA(v); +} +extern "C" char* NOAKLYNADNXCMLNJSXOFTJAJTKZXYESUAJNWHLDUPRNAZXZEKUISRMGEORQAYQCZ(double v); +inline static char* System_Convert_DoubleToString(double v) +{ + return NOAKLYNADNXCMLNJSXOFTJAJTKZXYESUAJNWHLDUPRNAZXZEKUISRMGEORQAYQCZ(v); +} +extern "C" Int16 UDCCXRCHTUPBVZKWLVMDWACNDJHPUDVZPOGWUWHTSBYXXFIOHUPDDZCUAPZNJMMQ(const char* v); +inline static Int16 System_Convert_StringToInt16(const char* v) +{ + return UDCCXRCHTUPBVZKWLVMDWACNDJHPUDVZPOGWUWHTSBYXXFIOHUPDDZCUAPZNJMMQ(v); +} +extern "C" Int32 YPMHTNBPNSLUBFQXATIANSWPLLVFWTKFPHYHSBVTSAPKNISVYCNQELCFTWWHSVST(const char* v); +inline static Int32 System_Convert_StringToInt32(const char* v) +{ + return YPMHTNBPNSLUBFQXATIANSWPLLVFWTKFPHYHSBVTSAPKNISVYCNQELCFTWWHSVST(v); +} +extern "C" Int64 IFFTGIFZXPHNDLCCTAGUGUBDETOVENAXHVCHCYOQXOSODPCIUTOSOYNNECONUJUK(const char* v); +inline static Int64 System_Convert_StringToInt64(const char* v) +{ + return IFFTGIFZXPHNDLCCTAGUGUBDETOVENAXHVCHCYOQXOSODPCIUTOSOYNNECONUJUK(v); +} +extern "C" UInt16 PKFHIUAULQXRBMZPQFBLZIIJHODAKBVOUIZTJUZATUGYBVLRDZWOHIKGCWZURAKJ(const char* v); +inline static UInt16 System_Convert_StringToUInt16(const char* v) +{ + return PKFHIUAULQXRBMZPQFBLZIIJHODAKBVOUIZTJUZATUGYBVLRDZWOHIKGCWZURAKJ(v); +} +extern "C" UInt32 VIXTNGGVGASEBJHMCLXKFGGLXSQMVEJSKXCSXSEWTAIGQGESONRFDZEOCMWUPTAB(const char* v); +inline static UInt32 System_Convert_StringToUInt32(const char* v) +{ + return VIXTNGGVGASEBJHMCLXKFGGLXSQMVEJSKXCSXSEWTAIGQGESONRFDZEOCMWUPTAB(v); +} +extern "C" UInt64 RZUEGPOKHAREYZUROXXHNDPLSOQKWJHZAGPRLZLZYHYCHAQCSEGRVSONJJMSZDNX(const char* v); +inline static UInt64 System_Convert_StringToUInt64(const char* v) +{ + return RZUEGPOKHAREYZUROXXHNDPLSOQKWJHZAGPRLZLZYHYCHAQCSEGRVSONJJMSZDNX(v); +} +extern "C" float SSERKCFOLYJFFMESXNSRCPEHSBHCNTAUUAKOVYSPYSGWJJIWETVLLVVDNWZIUDAS(const char* v); +inline static float System_Convert_StringToFloat(const char* v) +{ + return SSERKCFOLYJFFMESXNSRCPEHSBHCNTAUUAKOVYSPYSGWJJIWETVLLVVDNWZIUDAS(v); +} +extern "C" double YOLECPWZUCSJIHXITKXTXOJYFGBYYKUVRNYVXEUPWWRJDLUGZQPKFGVKENYWOXAK(const char* v); +inline static double System_Convert_StringToDouble(const char* v) +{ + return YOLECPWZUCSJIHXITKXTXOJYFGBYYKUVRNYVXEUPWWRJDLUGZQPKFGVKENYWOXAK(v); +} +extern "C" char* HWSVJBLOQHXBXAVULUZHVKQLSOQKFYBYVGBGTZXXFATXJTNEREKTYSOWGGCULAIS(BYTE * v , int len); +inline static char* System_Convert_ToBase64String(BYTE* v , int len) +{ + return HWSVJBLOQHXBXAVULUZHVKQLSOQKFYBYVGBGTZXXFATXJTNEREKTYSOWGGCULAIS(v , len); +} +extern "C" BYTE * GYFQYPAMWBBVRTBZBLSBNHACREZMWCMFRBRLNWGCEXWWRTFNFDTZHHEYXCYTPOQU(const char* v , int* lentmp); +inline static BYTE* System_Convert_FromBase64String(const char* v , int* lentmp) +{ + return GYFQYPAMWBBVRTBZBLSBNHACREZMWCMFRBRLNWGCEXWWRTFNFDTZHHEYXCYTPOQU(v , lentmp); +} +extern "C" double PWDPBPLEFQXQLDLYYMGTINXJWTOKXMNQHCHUPQLPSPTRKOMTRAVCHWLBYUTIBAGS(double v , int decimals); +inline static double System_Math_Round(double v , int decimals) +{ + return PWDPBPLEFQXQLDLYYMGTINXJWTOKXMNQHCHUPQLPSPTRKOMTRAVCHWLBYUTIBAGS(v , decimals); +} +extern "C" IntPtr CHIIWQIIBQATTGYHGUTXRLIKQFWVWCOSIAODGEXASMAQWSISVLCGGJBRYXRRUMMZ(int year , int mounth , int day , int hour , int minute , int second , int millisecond); +inline static IntPtr System_DateTime_New(int year , int mounth , int day , int hour , int minute , int second , int millisecond) +{ + return CHIIWQIIBQATTGYHGUTXRLIKQFWVWCOSIAODGEXASMAQWSISVLCGGJBRYXRRUMMZ(year , mounth , day , hour , minute , second , millisecond); +} +extern "C" char* CIKTRVBBXTEEKSOYXDALZHLZYXFIMFFGABNNHOAAJAJNEWHFJTTQLAZUXKUTPTPR(IntPtr time); +inline static char* System_DateTime_ToString(IntPtr time) +{ + return CIKTRVBBXTEEKSOYXDALZHLZYXFIMFFGABNNHOAAJAJNEWHFJTTQLAZUXKUTPTPR(time); +} +extern "C" IntPtr NYEIEARIDZBYYXVCQZYTLPUZCSQXUHKPLRAFSYAIBLNMZAWZOSDPUWGXEEGMKUNV(const char* time); +inline static IntPtr System_DateTime_Parse(const char* time) +{ + return NYEIEARIDZBYYXVCQZYTLPUZCSQXUHKPLRAFSYAIBLNMZAWZOSDPUWGXEEGMKUNV(time); +} +extern "C" IntPtr OLNGXQJSZQRABIABVQICEVVOLCANROXHXRXNMQCXIKQDEFWWEFQULLRTQYUUQWAK(IntPtr time , TimeSpan span); +inline static IntPtr System_DateTime_Add(IntPtr time , TimeSpan span) +{ + return OLNGXQJSZQRABIABVQICEVVOLCANROXHXRXNMQCXIKQDEFWWEFQULLRTQYUUQWAK(time , span); +} +extern "C" IntPtr TJCKKMOFNKTTFRKFGDIMYCWMZDXNVHHMKFKVDMLSQKGBRYOYOPOMNNMQNQKHOAJG(IntPtr time , int v); +inline static IntPtr System_DateTime_AddDays(IntPtr time , int v) +{ + return TJCKKMOFNKTTFRKFGDIMYCWMZDXNVHHMKFKVDMLSQKGBRYOYOPOMNNMQNQKHOAJG(time , v); +} +extern "C" IntPtr CHIZGOCURPWNWUUAPYYGSUYWTUHMBEEPAAYJQOSZMUVXRYUSVJRPBDNIJLGLHPSN(IntPtr time , int v); +inline static IntPtr System_DateTime_AddSeconds(IntPtr time , int v) +{ + return CHIZGOCURPWNWUUAPYYGSUYWTUHMBEEPAAYJQOSZMUVXRYUSVJRPBDNIJLGLHPSN(time , v); +} +extern "C" IntPtr LHMVWKKBGYTYZAFVAORSMONXNPAEIGSWCHMJLYWKZQJCJPIIFLLTYAAXTPIGKFSZ(IntPtr time , int v); +inline static IntPtr System_DateTime_AddMinutes(IntPtr time , int v) +{ + return LHMVWKKBGYTYZAFVAORSMONXNPAEIGSWCHMJLYWKZQJCJPIIFLLTYAAXTPIGKFSZ(time , v); +} +extern "C" IntPtr GWVROVJBSGTVEKNYHRZXUZYCHOQVPPATYKWMTQTJBJASHETJCKZSGVEHYTKAFNMC(IntPtr time , int v); +inline static IntPtr System_DateTime_AddHours(IntPtr time , int v) +{ + return GWVROVJBSGTVEKNYHRZXUZYCHOQVPPATYKWMTQTJBJASHETJCKZSGVEHYTKAFNMC(time , v); +} +extern "C" IntPtr FZXUOAEQXPVLYFVCVGTFQHMCFOOZFTDNXXMHGYVBFIURZTISYIEZUGMXMUOZMEKE(IntPtr time , int v); +inline static IntPtr System_DateTime_AddMilliseconds(IntPtr time , int v) +{ + return FZXUOAEQXPVLYFVCVGTFQHMCFOOZFTDNXXMHGYVBFIURZTISYIEZUGMXMUOZMEKE(time , v); +} +extern "C" IntPtr LINATOVWLSZHNVDLFVBXPETQLPUMJWOBYQFRFIZKNHNBGFKRRDTRCNOGOWPDTJNP(IntPtr time , int v); +inline static IntPtr System_DateTime_AddYears(IntPtr time , int v) +{ + return LINATOVWLSZHNVDLFVBXPETQLPUMJWOBYQFRFIZKNHNBGFKRRDTRCNOGOWPDTJNP(time , v); +} +extern "C" IntPtr EYJWPMGXVRKHQRKFEDUGDWYKBYCITVQDUYXIWNBFWVVKDGQXMJYQOGMHAYVRKXEZ(IntPtr time , int v); +inline static IntPtr System_DateTime_AddTicks(IntPtr time , int v) +{ + return EYJWPMGXVRKHQRKFEDUGDWYKBYCITVQDUYXIWNBFWVVKDGQXMJYQOGMHAYVRKXEZ(time , v); +} +extern "C" int BGNRTBJRCPJHANGVIEWJWAPNMQHXSKVZRVJXTYDKZHOZWEGMRZIFBUDBRZFCTMZS(IntPtr time); +inline static int System_DateTime_Year(IntPtr time) +{ + return BGNRTBJRCPJHANGVIEWJWAPNMQHXSKVZRVJXTYDKZHOZWEGMRZIFBUDBRZFCTMZS(time); +} +extern "C" int UKPEEJCKALKPMPRHKVFSBPXXSIGTSBQNHVELPBIIXXEPJNOBIXSYGHQEMSLWDIRZ(IntPtr time); +inline static int System_DateTime_Month(IntPtr time) +{ + return UKPEEJCKALKPMPRHKVFSBPXXSIGTSBQNHVELPBIIXXEPJNOBIXSYGHQEMSLWDIRZ(time); +} +extern "C" int UXHQLFSINXUELINFTELVISGAFAZXPMEPFEVMFYQCEJLJNMSEEGCYXWQCQHKKGVTB(IntPtr time); +inline static int System_DateTime_Day(IntPtr time) +{ + return UXHQLFSINXUELINFTELVISGAFAZXPMEPFEVMFYQCEJLJNMSEEGCYXWQCQHKKGVTB(time); +} +extern "C" int SEYGMBZVOIRZGWNTHUSJJGSJNSVYNFVIQKRINMRDGHJOERVUUQDMDKRLMOSUFBHJ(IntPtr time); +inline static int System_DateTime_Hour(IntPtr time) +{ + return SEYGMBZVOIRZGWNTHUSJJGSJNSVYNFVIQKRINMRDGHJOERVUUQDMDKRLMOSUFBHJ(time); +} +extern "C" int MIIWEEFVCPCCXDEWWBEWBJFGSGVZTXXFZZBWIZPPKIJNIPOIJWXEXLHDDCDYJGCF(IntPtr time); +inline static int System_DateTime_Minute(IntPtr time) +{ + return MIIWEEFVCPCCXDEWWBEWBJFGSGVZTXXFZZBWIZPPKIJNIPOIJWXEXLHDDCDYJGCF(time); +} +extern "C" int RWCXBINXLOLTZRYDRMPWZTIOSYTGVRGDFEWLMRGBJATIZODLEAGWRGFYOOFDPHBU(IntPtr time); +inline static int System_DateTime_Second(IntPtr time) +{ + return RWCXBINXLOLTZRYDRMPWZTIOSYTGVRGDFEWLMRGBJATIZODLEAGWRGFYOOFDPHBU(time); +} +extern "C" int IHNVUMQAFNMYZAODVHBUKJMZYYXXMDMCYYZRAHQSKGQDTHYNZBIHFHKYVNXWPSOC(IntPtr time); +inline static int System_DateTime_Millisecond(IntPtr time) +{ + return IHNVUMQAFNMYZAODVHBUKJMZYYXXMDMCYYZRAHQSKGQDTHYNZBIHFHKYVNXWPSOC(time); +} +extern "C" Int64 BKAABXDNRJKDTIGRZJYKVEWROAWNKTCRRNCJGXMCYUQWXGFMHFXFUDHWNJMABQCX(IntPtr time); +inline static Int64 System_DateTime_Ticks(IntPtr time) +{ + return BKAABXDNRJKDTIGRZJYKVEWROAWNKTCRRNCJGXMCYUQWXGFMHFXFUDHWNJMABQCX(time); +} +extern "C" IntPtr GSMFGXKCWVMAOAUIUJFEWXXNGFVXLMBIRSPETZGJVUIYRGHMODFRKYAIUYYABNQK(); +inline static IntPtr System_DateTime_Now() +{ + return GSMFGXKCWVMAOAUIUJFEWXXNGFVXLMBIRSPETZGJVUIYRGHMODFRKYAIUYYABNQK(); +} +extern "C" IntPtr UEIWLPOVCWJBPZWAXJIHGJYTRGJVAFHIEXDNXLBZOKONOZTVCYDSEIELGPEEGTUX(); +inline static IntPtr System_Text_Encoding_Default() +{ + return UEIWLPOVCWJBPZWAXJIHGJYTRGJVAFHIEXDNXLBZOKONOZTVCYDSEIELGPEEGTUX(); +} +extern "C" IntPtr OBXRVICLIJSVUKFSMNSBBODVSSGIHWTVPRYMBCZTWRKUPIQVJMSSASVZXBYDBTEL(); +inline static IntPtr System_Text_Encoding_UTF7() +{ + return OBXRVICLIJSVUKFSMNSBBODVSSGIHWTVPRYMBCZTWRKUPIQVJMSSASVZXBYDBTEL(); +} +extern "C" IntPtr QXFCLSQKNZFKEJFKBLYVEAUXWYPADWRDNYESCOJRVIEBNLVOWOCQUJHPCIGNCQGR(); +inline static IntPtr System_Text_Encoding_UTF8() +{ + return QXFCLSQKNZFKEJFKBLYVEAUXWYPADWRDNYESCOJRVIEBNLVOWOCQUJHPCIGNCQGR(); +} +extern "C" IntPtr HBWFFNHNBGZWWTJKDADPUAIEROPUHWOFBMULOPJJHPPNJLSJYVJBMQXGTROQXMFE(); +inline static IntPtr System_Text_Encoding_UTF32() +{ + return HBWFFNHNBGZWWTJKDADPUAIEROPUHWOFBMULOPJJHPPNJLSJYVJBMQXGTROQXMFE(); +} +extern "C" IntPtr SUUKYYWNRUHFLUVFVFVMMMSKPNRWBSLUJLVORIKAZWKSJSVZWJURRTRFCJULGZMY(); +inline static IntPtr System_Text_Encoding_Latin1() +{ + return SUUKYYWNRUHFLUVFVFVMMMSKPNRWBSLUJLVORIKAZWKSJSVZWJURRTRFCJULGZMY(); +} +extern "C" IntPtr IMVAYGONVUMQCABXSSASYUDQTQMHOZUAKLJWWUAPUHWXGBCCHXTNZUAOJFGHUGYV(); +inline static IntPtr System_Text_Encoding_Unicode() +{ + return IMVAYGONVUMQCABXSSASYUDQTQMHOZUAKLJWWUAPUHWXGBCCHXTNZUAOJFGHUGYV(); +} +extern "C" IntPtr ZMGQQFAXRKXRYGJSOKAQGHBQLVMROSVOIAXTVLLCXVVOWIQDVOTJGIPSLPFUSIJZ(); +inline static IntPtr System_Text_Encoding_ASCII() +{ + return ZMGQQFAXRKXRYGJSOKAQGHBQLVMROSVOIAXTVLLCXVVOWIQDVOTJGIPSLPFUSIJZ(); +} +extern "C" IntPtr OJIXIQXCYXTKLMTCFIWZZLHZLFHFGQJOMWZNASVFRQLJOEGZWCPJMJZDBILDIRWI(); +inline static IntPtr System_Text_Encoding_BigEndianUnicode() +{ + return OJIXIQXCYXTKLMTCFIWZZLHZLFHFGQJOMWZNASVFRQLJOEGZWCPJMJZDBILDIRWI(); +} +extern "C" IntPtr NFYPMFCMNQHIAYLGYIIDBZBCWWMRGRXZTDVJGRMRACWWBQCCXEFZITGNEVSPTLFV(const char* name); +inline static IntPtr System_Text_Encoding_GetEncoding(const char* name) +{ + return NFYPMFCMNQHIAYLGYIIDBZBCWWMRGRXZTDVJGRMRACWWBQCCXEFZITGNEVSPTLFV(name); +} +extern "C" BYTE * TIPXDBAGVRDYDFBGUJTBMXQAWHFLZXYOWACTBFZWEYDRPIKZUMVJSDJWROAVWPHY(IntPtr enc , const char* str , int* _len); +inline static BYTE* System_Text_Encoding_GetBytes(IntPtr enc , const char* str , int* _len) +{ + return TIPXDBAGVRDYDFBGUJTBMXQAWHFLZXYOWACTBFZWEYDRPIKZUMVJSDJWROAVWPHY(enc , str , _len); +} +extern "C" char* TOBDCHEOKWXNTZKNXGRNCOWTRFCMEDAPRFXBHGWMHGYVGVCRENYPYTWESIMWFRJG(IntPtr enc , BYTE * bytes , int _len); +inline static char* System_Text_Encoding_GetString(IntPtr enc , BYTE* bytes , int _len) +{ + return TOBDCHEOKWXNTZKNXGRNCOWTRFCMEDAPRFXBHGWMHGYVGVCRENYPYTWESIMWFRJG(enc , bytes , _len); +} +extern "C" char* WIVOBJGQKEGVPAMVDKIRFKRYJSIZUZHPWSZYZOPUGHFTNAPSVQTUJSALQXEJBHVK(); +inline static char* System_Environment_CurrentDirectory() +{ + return WIVOBJGQKEGVPAMVDKIRFKRYJSIZUZHPWSZYZOPUGHFTNAPSVQTUJSALQXEJBHVK(); +} +extern "C" void XQYXANVOUNKYFXKIDPDEFMGERNHCJGTZLUWWBRRIVEAVHCGTMVFLDRFKKUFMGTFN(const char* path); +inline static void System_Environment_SetCurrentDirectory(const char* path) +{ + XQYXANVOUNKYFXKIDPDEFMGERNHCJGTZLUWWBRRIVEAVHCGTMVFLDRFKKUFMGTFN(path); +} +extern "C" bool UKMKANHMYVJAMKWPHNPNBIWUPLMHMEBBZMBXQWSZOTNIIEYZXQFSERMLOSUOBZZT(const char* path); +inline static bool System_IO_File_Exists(const char* path) +{ + return UKMKANHMYVJAMKWPHNPNBIWUPLMHMEBBZMBXQWSZOTNIIEYZXQFSERMLOSUOBZZT(path); +} +extern "C" char* THBAJZYKVQYIVNLLNNJVYJXIZPIXCDXPTTOBCXPYRUXNSEQAGIBOPEUKJSAUQAIR(const char* path); +inline static char* System_IO_File_ReadAllText(const char* path) +{ + return THBAJZYKVQYIVNLLNNJVYJXIZPIXCDXPTTOBCXPYRUXNSEQAGIBOPEUKJSAUQAIR(path); +} +extern "C" BYTE * SJOBYKJPXLDDMJPVYHRTCJZOYERJXUHQMGVJPOCVZLQEAQXZCFWJJOOIKACTTZSD(const char* path); +inline static BYTE* System_IO_File_ReadAllBytes(const char* path) +{ + return SJOBYKJPXLDDMJPVYHRTCJZOYERJXUHQMGVJPOCVZLQEAQXZCFWJJOOIKACTTZSD(path); +} +extern "C" void ENRGNGFJFVURTVOIHRGRYYHXRNZPMICASNZNZRLWZMDNUWPPLUMBSBEGFTOAHQXX(const char* path , const char* text); +inline static void System_IO_File_WriteAllText(const char* path , const char* text) +{ + ENRGNGFJFVURTVOIHRGRYYHXRNZPMICASNZNZRLWZMDNUWPPLUMBSBEGFTOAHQXX(path , text); +} +extern "C" void TTZFVAJPGKRLUTDVXJDRVBIRITHFCKOJPFUAXJUKLWUHJTLMQTCXMFBRLIXBTDMV(const char* path , BYTE * bytes , int len); +inline static void System_IO_File_WriteAllBytes(const char* path , BYTE* bytes , int len) +{ + TTZFVAJPGKRLUTDVXJDRVBIRITHFCKOJPFUAXJUKLWUHJTLMQTCXMFBRLIXBTDMV(path , bytes , len); +} +extern "C" void WIVOZCYOPTGYGAHOHVOJIQWKECPOMSRHKZLBXWMOUOHTYCLKAITYOCNFLLKXNJBX(const char* path , const char* text); +inline static void System_IO_File_AppendAllText(const char* path , const char* text) +{ + WIVOZCYOPTGYGAHOHVOJIQWKECPOMSRHKZLBXWMOUOHTYCLKAITYOCNFLLKXNJBX(path , text); +} +extern "C" void BYOGPGQKJAOTIDLBREOEYTSHMFPMMOALNKRZNEUURIOOOTWIAIGJUXYIGHUKQEYU(const char* path); +inline static void System_IO_File_Delete(const char* path) +{ + BYOGPGQKJAOTIDLBREOEYTSHMFPMMOALNKRZNEUURIOOOTWIAIGJUXYIGHUKQEYU(path); +} +extern "C" Int64 ADFYLLNMJUNQEETSIHMDIRQQLITGKKDMKUNKNYWOVTZAJIEBOBBJRULIMPMCRHCZ(const char* path); +inline static Int64 System_IO_File_GetSize(const char* path) +{ + return ADFYLLNMJUNQEETSIHMDIRQQLITGKKDMKUNKNYWOVTZAJIEBOBBJRULIMPMCRHCZ(path); +} +extern "C" void RAFJQIFKKXIORQGDDRSJITUPIFYYLTWORAJJDVLGWQYUMXQVJJYZPSQXFPALJGZQ(const char* path); +inline static void System_IO_Directory_Delete(const char* path) +{ + RAFJQIFKKXIORQGDDRSJITUPIFYYLTWORAJJDVLGWQYUMXQVJJYZPSQXFPALJGZQ(path); +} +extern "C" void AUWRHWAIGLNRUADLODOBUWYYJLDNUZWPRHTSAZOMJQTDFZCEMPXGSYVDVXIVSMNG(const char* path); +inline static void System_IO_Directory_CreateDirectory(const char* path) +{ + AUWRHWAIGLNRUADLODOBUWYYJLDNUZWPRHTSAZOMJQTDFZCEMPXGSYVDVXIVSMNG(path); +} +extern "C" bool PXANHLLPOBREDVTKIYAFCQWTLPWCQSTWCMNHYPXADHRQGRAZEXMTLHEZBGBROIYW(const char* path); +inline static bool System_IO_Directory_Exists(const char* path) +{ + PXANHLLPOBREDVTKIYAFCQWTLPWCQSTWCMNHYPXADHRQGRAZEXMTLHEZBGBROIYW(path); +} +extern "C" char** HUBRHLLTBABUYGMUPWYSFALUIOGROGMVJVILPIRSMTSLFJAVUGCRKFQHJGJTFTEU(const char* path , int* o_count); +inline static char** System_IO_Directory_GetFiles(const char* path , int* o_count) +{ + return HUBRHLLTBABUYGMUPWYSFALUIOGROGMVJVILPIRSMTSLFJAVUGCRKFQHJGJTFTEU(path , o_count); +} +extern "C" char** OGKDXBFGEFGMHZPYOLXIEUKEEABIZYNTOYXZYWXTBVNFYEAKRKFUVWQTVGZWZWHG(const char* path , int* o_count); +inline static char** System_IO_Directory_GetDirectories(const char* path , int* o_count) +{ + return OGKDXBFGEFGMHZPYOLXIEUKEEABIZYNTOYXZYWXTBVNFYEAKRKFUVWQTVGZWZWHG(path , o_count); +} +extern "C" IntPtr KHFDAPMTZXVOGHQCIQHRSYTWIWDOSFQQDJGGHCZGXIDFNJUZSAMEBAJLNJUEMYAT(); +inline static IntPtr System_IO_MemoryStream_New() +{ + return KHFDAPMTZXVOGHQCIQHRSYTWIWDOSFQQDJGGHCZGXIDFNJUZSAMEBAJLNJUEMYAT(); +} +extern "C" IntPtr GELWBJUFQBTJVOIZBDVSTMPDAUTYIVTZHJYJYYXJGGNAGZQZAUCICIAUOHWHPWWV(BYTE * _buffer , int len); +inline static IntPtr System_IO_MemoryStream_NewI(BYTE* _buffer , int len) +{ + return GELWBJUFQBTJVOIZBDVSTMPDAUTYIVTZHJYJYYXJGGNAGZQZAUCICIAUOHWHPWWV(_buffer , len); +} +extern "C" long HUBLPZBDFMMMYPWBDUXOSLWZIEUQBQTJJSSMXFJBSZCPWOVZLVEVZICWXCCKELBP(IntPtr mem); +inline static long System_IO_MemoryStream_GetPosition(IntPtr mem) +{ + return HUBLPZBDFMMMYPWBDUXOSLWZIEUQBQTJJSSMXFJBSZCPWOVZLVEVZICWXCCKELBP(mem); +} +extern "C" void TCDFWKEYKVWTIGDUJVFGLXKBQWOUCZWHXMWTLQCBQGLDMJNRYHBJFVDVSBPZVJVL(IntPtr mem , long pos); +inline static void System_IO_MemoryStream_SetPosition(IntPtr mem , long pos) +{ + TCDFWKEYKVWTIGDUJVFGLXKBQWOUCZWHXMWTLQCBQGLDMJNRYHBJFVDVSBPZVJVL(mem , pos); +} +extern "C" long ZOVVJKJTSEPFMGPHJXWUXNBCJBBJADFHKZEXNRHOYIQBFYILMHQXMANLNTMIIASP(IntPtr mem); +inline static long System_IO_MemoryStream_GetLength(IntPtr mem) +{ + return ZOVVJKJTSEPFMGPHJXWUXNBCJBBJADFHKZEXNRHOYIQBFYILMHQXMANLNTMIIASP(mem); +} +extern "C" void YHVNBSTRQIWPXAWKTPWSMHVJMSJUFZFXPACXCVJUOYHEEXOMWBOTDZCRMLAIIZMR(IntPtr mem , long len); +inline static void System_IO_MemoryStream_SetLength(IntPtr mem , long len) +{ + YHVNBSTRQIWPXAWKTPWSMHVJMSJUFZFXPACXCVJUOYHEEXOMWBOTDZCRMLAIIZMR(mem , len); +} +extern "C" void DYAWYYHYFCEOZRFOEXXDKLUQXLLRUAMPMQAFXROXTQNAUORVFLELBIGREJZMNQDE(IntPtr mem , BYTE * _buffer , int len); +inline static void System_IO_MemoryStream_Write(IntPtr mem , BYTE* _buffer , int len) +{ + DYAWYYHYFCEOZRFOEXXDKLUQXLLRUAMPMQAFXROXTQNAUORVFLELBIGREJZMNQDE(mem , _buffer , len); +} +extern "C" void QPCJQZRMIZJTXTVJTPLJWBNDKJBNSBKDNIKFMIFFTRCCYNTKOQSXEUIPCYZHYEUG(IntPtr mem , BYTE b); +inline static void System_IO_MemoryStream_WriteByte(IntPtr mem , BYTE b) +{ + QPCJQZRMIZJTXTVJTPLJWBNDKJBNSBKDNIKFMIFFTRCCYNTKOQSXEUIPCYZHYEUG(mem , b); +} +extern "C" BYTE * PGGPJQWLKGPEYLEWPRYCIMYTAVDNJYHPXWMSHEAYTHNYFDQRUCRGFRXCHNOOMJCM(IntPtr mem); +inline static BYTE* System_IO_MemoryStream_ToArray(IntPtr mem) +{ + return PGGPJQWLKGPEYLEWPRYCIMYTAVDNJYHPXWMSHEAYTHNYFDQRUCRGFRXCHNOOMJCM(mem); +} +extern "C" IntPtr HNTTYMGSZGICLZELUDSOOFRRIAEJAMFESZFFMBUQNGCMCIZFSBESDTNCVCLYHXRM(); +inline static IntPtr System_Diagnostics_Process_New() +{ + return HNTTYMGSZGICLZELUDSOOFRRIAEJAMFESZFFMBUQNGCMCIZFSBESDTNCVCLYHXRM(); +} +extern "C" void BEJMTYZSIBAHCFPZAZQZHMAZMDKJQWJQPQKXZNLTCMKCSFAQNMXIGSFPDKAQOPCL(IntPtr process); +inline static void System_Diagnostics_Process_Close(IntPtr process) +{ + BEJMTYZSIBAHCFPZAZQZHMAZMDKJQWJQPQKXZNLTCMKCSFAQNMXIGSFPDKAQOPCL(process); +} +extern "C" IntPtr SJSMURANNXWVCYGGCTWEZAKXKVTPNVFNKYJIMOWVLKUIVKMFDTNUSXMRYVBYXKZS(int pid); +inline static IntPtr System_Diagnostics_Process_GetProcessById(int pid) +{ + return SJSMURANNXWVCYGGCTWEZAKXKVTPNVFNKYJIMOWVLKUIVKMFDTNUSXMRYVBYXKZS(pid); +} +extern "C" IntPtr SJKDPXUOXBSPGCBAJOLUIKUMLRJRMXYBKCQLZJQFYZWRFXLWTAPJYFJHPYSXOCBZ(); +inline static IntPtr System_Diagnostics_Process_GetCurrentProcess() +{ + return SJKDPXUOXBSPGCBAJOLUIKUMLRJRMXYBKCQLZJQFYZWRFXLWTAPJYFJHPYSXOCBZ(); +} +extern "C" void DREDMQBZYGVINDGOGNXLIOCFSIWARSRWXXOOTHKDZPKSJBULRERBEPQOPZLDTAIF(); +inline static void System_Diagnostics_Process_EnterDebugMode() +{ + DREDMQBZYGVINDGOGNXLIOCFSIWARSRWXXOOTHKDZPKSJBULRERBEPQOPZLDTAIF(); +} +extern "C" IntPtr * PZLQOSUYCUMTEJVROKINBQRHGAYTWGJYGFDKQDWZJTYKDXKFDUPISVDYHDKOUBCV(int* plen); +inline static IntPtr* System_Diagnostics_Process_GetProcesses(int* plen) +{ + return PZLQOSUYCUMTEJVROKINBQRHGAYTWGJYGFDKQDWZJTYKDXKFDUPISVDYHDKOUBCV(plen); +} +extern "C" IntPtr * KNMYGLBKNJEIRHEIPTQBRAGLBECMTIFHQCZQLLZSSEVIRVHAYBZBKAEJGBWCIORF(const char* machineName , int* plen); +inline static IntPtr* System_Diagnostics_Process_GetProcessesI(const char* machineName , int* plen) +{ + return KNMYGLBKNJEIRHEIPTQBRAGLBECMTIFHQCZQLLZSSEVIRVHAYBZBKAEJGBWCIORF(machineName , plen); +} +extern "C" IntPtr * EWRPHNXETYIMFXTGXBOSIEXQXQJJPWJENPEVDRTKDVHMRREIHQFGZZWAYBRRENOX(const char* processName , int* plen); +inline static IntPtr* System_Diagnostics_Process_GetProcessesByName(const char* processName , int* plen) +{ + return EWRPHNXETYIMFXTGXBOSIEXQXQJJPWJENPEVDRTKDVHMRREIHQFGZZWAYBRRENOX(processName , plen); +} +extern "C" IntPtr PEZQTYCFIDONWLYFLBCYRCENSEWCZCGPGKXNSNPJOZYWKIDNCMFCLPFMZLXOBZFG(const char* fileName); +inline static IntPtr System_Diagnostics_Process_Start(const char* fileName) +{ + return PEZQTYCFIDONWLYFLBCYRCENSEWCZCGPGKXNSNPJOZYWKIDNCMFCLPFMZLXOBZFG(fileName); +} +extern "C" IntPtr WZHMNLNYLTKREIDJAJZNWDDQEKNGQAHOTRZLBQZRYHQSFNIRINOSZSJTVRHDXHIL(const char* fileName , const char* arguments); +inline static IntPtr System_Diagnostics_Process_StartI(const char* fileName , const char* arguments) +{ + return WZHMNLNYLTKREIDJAJZNWDDQEKNGQAHOTRZLBQZRYHQSFNIRINOSZSJTVRHDXHIL(fileName , arguments); +} +extern "C" bool LWXMISIJJIPPMLLRBWXCMPOBIGPKJWTRYFHJPWIQFEJRDUGKFQBBJGZVHWECCYAM(IntPtr process); +inline static bool System_Diagnostics_Process_StartII(IntPtr process) +{ + return LWXMISIJJIPPMLLRBWXCMPOBIGPKJWTRYFHJPWIQFEJRDUGKFQBBJGZVHWECCYAM(process); +} +extern "C" void PXQHECBFOHWIGXYNAFESUSISGLBTRGOGDWCFDYFDPVMBJQPJXQCWUISWPXASAHNI(IntPtr process); +inline static void System_Diagnostics_Process_Kill(IntPtr process) +{ + PXQHECBFOHWIGXYNAFESUSISGLBTRGOGDWCFDYFDPVMBJQPJXQCWUISWPXASAHNI(process); +} +extern "C" void TPFKVSKBZACYFGJPVSVBERMUEFPFYNDHIEITLFOFFAWTFTRJOKWIMMEBDKFPDEDM(IntPtr process , bool entireProcessTree); +inline static void System_Diagnostics_Process_KillI(IntPtr process , bool entireProcessTree) +{ + TPFKVSKBZACYFGJPVSVBERMUEFPFYNDHIEITLFOFFAWTFTRJOKWIMMEBDKFPDEDM(process , entireProcessTree); +} +extern "C" void XVQAXQEQDQVDUTOLOGRNQVVVAHQBZZBAXKWKCRMYGGEWRAGKVUBXNQVCZVZPZCQE(IntPtr process); +inline static void System_Diagnostics_Process_Refresh(IntPtr process) +{ + XVQAXQEQDQVDUTOLOGRNQVVVAHQBZZBAXKWKCRMYGGEWRAGKVUBXNQVCZVZPZCQE(process); +} +extern "C" void OUGKXDJXTSGKQZEAAFFEXENHOTKGRWYEPAHWUVNSLEDVJLLAQZPTXMGJHYWDSCFX(IntPtr process); +inline static void System_Diagnostics_Process_WaitForExit(IntPtr process) +{ + OUGKXDJXTSGKQZEAAFFEXENHOTKGRWYEPAHWUVNSLEDVJLLAQZPTXMGJHYWDSCFX(process); +} +extern "C" void UBUPRIFESNTTBRXCIKPSHEGDTXPVZJZJYGAIQVJITKBJSNIPBTVIMNPPURWUSJFJ(IntPtr process); +inline static void System_Diagnostics_Process_WaitForInputIdle(IntPtr process) +{ + UBUPRIFESNTTBRXCIKPSHEGDTXPVZJZJYGAIQVJITKBJSNIPBTVIMNPPURWUSJFJ(process); +} +extern "C" bool NJUVQPMMBHYXDXKGPZUGOQWLQLNYZOPJERVITNYLHJHFOSMXHPFTPZUXNIEFCNMM(IntPtr process , int milliseconds); +inline static bool System_Diagnostics_Process_WaitForInputIdleI(IntPtr process , int milliseconds) +{ + return NJUVQPMMBHYXDXKGPZUGOQWLQLNYZOPJERVITNYLHJHFOSMXHPFTPZUXNIEFCNMM(process , milliseconds); +} +extern "C" bool ROSLBBMBBIYFJRWYZPRJJWUFXYVKISJUWVOAZAWFCDSGAOOVMFGNVCCUUMOCFCSI(IntPtr process , int milliseconds); +inline static bool System_Diagnostics_Process_WaitForExitI(IntPtr process , int milliseconds) +{ + return ROSLBBMBBIYFJRWYZPRJJWUFXYVKISJUWVOAZAWFCDSGAOOVMFGNVCCUUMOCFCSI(process , milliseconds); +} +extern "C" int ZEINDWYYSLGGEOFIKAYCMWYUTTFMMUAAKKHVGASPHIUKVVQFHFRFDPVCGOTKQLLY(IntPtr process); +inline static int System_Diagnostics_Process_BasePriority(IntPtr process) +{ + return ZEINDWYYSLGGEOFIKAYCMWYUTTFMMUAAKKHVGASPHIUKVVQFHFRFDPVCGOTKQLLY(process); +} +extern "C" bool LGWUHJCJHJVEBNYYCAFGCUWUOEPRGIYVWWZPZWYXDIXUURASQVHQGFVQJBFCUKDZ(IntPtr process); +inline static bool System_Diagnostics_Process_GetEnableRaisingEvents(IntPtr process) +{ + return LGWUHJCJHJVEBNYYCAFGCUWUOEPRGIYVWWZPZWYXDIXUURASQVHQGFVQJBFCUKDZ(process); +} +extern "C" void KAIFOJYGBIDUWBAWDXBKAIPQAIFYQVDSFXKTJVDHXAPXBBUIAJZWJSZCKREGDAPF(IntPtr process , bool v); +inline static void System_Diagnostics_Process_SetEnableRaisingEvents(IntPtr process , bool v) +{ + KAIFOJYGBIDUWBAWDXBKAIPQAIFYQVDSFXKTJVDHXAPXBBUIAJZWJSZCKREGDAPF(process , v); +} +extern "C" int ELPYRGNHTTNZSRPZNXXHWGIMYIIRRXDWKJTPLVRTVRDQEZJTBESGDIJYDCZIYVQW(IntPtr process); +inline static int System_Diagnostics_Process_ExitCode(IntPtr process) +{ + return ELPYRGNHTTNZSRPZNXXHWGIMYIIRRXDWKJTPLVRTVRDQEZJTBESGDIJYDCZIYVQW(process); +} +extern "C" __DateTime PQPJYZORGDMEDSIZZPPMEXTCAVMIWIVZAGANKZVCQAZZWEUKUAJIFESSXMICMFVX(IntPtr process); +inline static __DateTime System_Diagnostics_Process_ExitTime(IntPtr process) +{ + return PQPJYZORGDMEDSIZZPPMEXTCAVMIWIVZAGANKZVCQAZZWEUKUAJIFESSXMICMFVX(process); +} +extern "C" IntPtr IMEWSUPZUNVDXTFWABOVZMTWOHQXRSPKECRKAYSZKKORIOUDHMCLQAYVSIHKESIB(IntPtr process); +inline static IntPtr System_Diagnostics_Process_Handle(IntPtr process) +{ + return IMEWSUPZUNVDXTFWABOVZMTWOHQXRSPKECRKAYSZKKORIOUDHMCLQAYVSIHKESIB(process); +} +extern "C" int YKYVCVWBJOLPXBNZNMQEPEUEDVRRRIVSBNTXQYBLQBCCOJXRUHWRBDLUQTRGEEKA(IntPtr process); +inline static int System_Diagnostics_Process_HandleCount(IntPtr process) +{ + return YKYVCVWBJOLPXBNZNMQEPEUEDVRRRIVSBNTXQYBLQBCCOJXRUHWRBDLUQTRGEEKA(process); +} +extern "C" bool TSNKIPJOLEOOBRPUYZXJLDQXBYGWGUGLQBIVWNIEYIGXPXSYDXIEGBOQCPJJJNHR(IntPtr process); +inline static bool System_Diagnostics_Process_HasExited(IntPtr process) +{ + return TSNKIPJOLEOOBRPUYZXJLDQXBYGWGUGLQBIVWNIEYIGXPXSYDXIEGBOQCPJJJNHR(process); +} +extern "C" int YCYAJTYKRSKDWTIEFHSJLCEPMSTGEYVKAPYNYSPKZXNOQLTJHEEBVYFWXINRARGS(IntPtr process); +inline static int System_Diagnostics_Process_Id(IntPtr process) +{ + return YCYAJTYKRSKDWTIEFHSJLCEPMSTGEYVKAPYNYSPKZXNOQLTJHEEBVYFWXINRARGS(process); +} +extern "C" char* WACHUUFNSIJNOQYAYKYZUUPCJCQQEXJHRVRQJLOMYQIMOSHGJMSQSHXCKAYSEPIU(IntPtr process); +inline static char* System_Diagnostics_Process_MachineName(IntPtr process) +{ + return WACHUUFNSIJNOQYAYKYZUUPCJCQQEXJHRVRQJLOMYQIMOSHGJMSQSHXCKAYSEPIU(process); +} +extern "C" _ProcessModule * YCWTZIRMVMADMDNQUJGRETOKXPGINWIJINNMWOHBVGUGGTQHMHXVIQPFNMVJCIZZ(IntPtr process , int* plen); +inline static _ProcessModule* System_Diagnostics_Process_Modules(IntPtr process , int* plen) +{ + return YCWTZIRMVMADMDNQUJGRETOKXPGINWIJINNMWOHBVGUGGTQHMHXVIQPFNMVJCIZZ(process , plen); +} +extern "C" _ProcessModule * DRVYPBUGBFWYZHDEZZWFZNARXIYJTXYMGUCPYRRLNQTDURGFIRKDMUAQQEAGDKNE(IntPtr process); +inline static _ProcessModule* System_Diagnostics_Process_MainModule(IntPtr process) +{ + return DRVYPBUGBFWYZHDEZZWFZNARXIYJTXYMGUCPYRRLNQTDURGFIRKDMUAQQEAGDKNE(process); +} +extern "C" IntPtr GKSEFOGHHKRITXXGCSBBMVZLULZTRLICDOXKYBAUKDWBCRWTHTEKJLRLKGJTPMQW(IntPtr process); +inline static IntPtr System_Diagnostics_Process_MainWindowHandle(IntPtr process) +{ + return GKSEFOGHHKRITXXGCSBBMVZLULZTRLICDOXKYBAUKDWBCRWTHTEKJLRLKGJTPMQW(process); +} +extern "C" char* CPFFAMHASGRJZYIDOFMXGXSRWLZSRHFYMZYNLRTUMDSDUIMMXGEJZTPFWOIOMPJK(IntPtr process); +inline static char* System_Diagnostics_Process_MainWindowTitle(IntPtr process) +{ + return CPFFAMHASGRJZYIDOFMXGXSRWLZSRHFYMZYNLRTUMDSDUIMMXGEJZTPFWOIOMPJK(process); +} +extern "C" IntPtr BSWZZVSXMSKDEPXOZNULCVZTKTQXJEHWUHBBMMMBNHWGILAHQTOYUXIFTCOGFUNI(IntPtr process); +inline static IntPtr System_Diagnostics_Process_MaxWorkingSet(IntPtr process) +{ + return BSWZZVSXMSKDEPXOZNULCVZTKTQXJEHWUHBBMMMBNHWGILAHQTOYUXIFTCOGFUNI(process); +} +extern "C" IntPtr LOJXOVCMBSXUZSLZSJGPQICWZVIJYGWSTOVUCDTVRBXBZNGBRPNVOYRDMMYSMTOV(IntPtr process); +inline static IntPtr System_Diagnostics_Process_MinWorkingSet(IntPtr process) +{ + return LOJXOVCMBSXUZSLZSJGPQICWZVIJYGWSTOVUCDTVRBXBZNGBRPNVOYRDMMYSMTOV(process); +} +extern "C" int VEBKXRXPQKYOKAWLPHRISBEVWRHPFAIYMCGVMVEASYFEADSMQMDFBGCUAFOFJIJP(IntPtr process); +inline static int System_Diagnostics_Process_NonpagedSystemMemorySize(IntPtr process) +{ + return VEBKXRXPQKYOKAWLPHRISBEVWRHPFAIYMCGVMVEASYFEADSMQMDFBGCUAFOFJIJP(process); +} +extern "C" long BZBIUBZTCRQTVAVTZVYSXDWGZLUHHZRKPPCABKRONJCKQJYAJUFNJRSYDVIIHRMD(IntPtr process); +inline static long System_Diagnostics_Process_NonpagedSystemMemorySize64(IntPtr process) +{ + return BZBIUBZTCRQTVAVTZVYSXDWGZLUHHZRKPPCABKRONJCKQJYAJUFNJRSYDVIIHRMD(process); +} +extern "C" int ZFEGXVSODKFNALPQNUXMTDBYXDWFCJHVXYKKFSCOCRJYLEXRFRVMUZKWEGJTYMMU(IntPtr process); +inline static int System_Diagnostics_Process_PagedMemorySize(IntPtr process) +{ + return ZFEGXVSODKFNALPQNUXMTDBYXDWFCJHVXYKKFSCOCRJYLEXRFRVMUZKWEGJTYMMU(process); +} +extern "C" long CJQBBFLURIKCUCMSGFZKOUAXOOGZIJQPEPVCOWQAGAVMPHBBTQNSMBGIISNMYLMI(IntPtr process); +inline static long System_Diagnostics_Process_PagedMemorySize64(IntPtr process) +{ + return CJQBBFLURIKCUCMSGFZKOUAXOOGZIJQPEPVCOWQAGAVMPHBBTQNSMBGIISNMYLMI(process); +} +extern "C" int RUXFGJEJPZDNYOIGMEFSVXCDINTVIDCUONUUKWVJMDDNXSJUKGATGTMURUWTPJAL(IntPtr process); +inline static int System_Diagnostics_Process_PagedSystemMemorySize(IntPtr process) +{ + return RUXFGJEJPZDNYOIGMEFSVXCDINTVIDCUONUUKWVJMDDNXSJUKGATGTMURUWTPJAL(process); +} +extern "C" long WJZLUNVPJVGRUOFQDZKCDIOUAADQACTCCRQOSYZXKKKKNUZCOFPQYYIOUEKTJFPG(IntPtr process); +inline static long System_Diagnostics_Process_PagedSystemMemorySize64(IntPtr process) +{ + return WJZLUNVPJVGRUOFQDZKCDIOUAADQACTCCRQOSYZXKKKKNUZCOFPQYYIOUEKTJFPG(process); +} +extern "C" int BDPCXQXEZNRSXDHFAACUMDEEICTONGNFUEJKFWEXILQKGQRRXETJDUUXYLUVWJRT(IntPtr process); +inline static int System_Diagnostics_Process_PeakPagedMemorySize(IntPtr process) +{ + return BDPCXQXEZNRSXDHFAACUMDEEICTONGNFUEJKFWEXILQKGQRRXETJDUUXYLUVWJRT(process); +} +extern "C" long AMXTUXADWEMBNUXSKCQINDBAJLLUCJAYTWJUSYWAEPNYHTKEOBKUSIGXKXJJLGAN(IntPtr process); +inline static long System_Diagnostics_Process_PeakPagedMemorySize64(IntPtr process) +{ + return AMXTUXADWEMBNUXSKCQINDBAJLLUCJAYTWJUSYWAEPNYHTKEOBKUSIGXKXJJLGAN(process); +} +extern "C" int EOHRKCAMFQEXQDSQBHGBYGFLQMJVONOYOAUTLTTLBXOCDIGHETIEZZOXIVAYSFYS(IntPtr process); +inline static int System_Diagnostics_Process_PeakVirtualMemorySize(IntPtr process) +{ + return EOHRKCAMFQEXQDSQBHGBYGFLQMJVONOYOAUTLTTLBXOCDIGHETIEZZOXIVAYSFYS(process); +} +extern "C" long BFJQIYEINUZASDHIFCQUFKYOLWLPSUSWZVBYYQYGOZQEZOFFOSSQPDMQHUEMMPPT(IntPtr process); +inline static long System_Diagnostics_Process_PeakVirtualMemorySize64(IntPtr process) +{ + return BFJQIYEINUZASDHIFCQUFKYOLWLPSUSWZVBYYQYGOZQEZOFFOSSQPDMQHUEMMPPT(process); +} +extern "C" int CDBWBJJPDJGFUTPWQGBACBHVJKQELMTZKXCWNJDEIDMFXGWNFHVGNPQAWFNQSFER(IntPtr process); +inline static int System_Diagnostics_Process_PeakWorkingSet(IntPtr process) +{ + return CDBWBJJPDJGFUTPWQGBACBHVJKQELMTZKXCWNJDEIDMFXGWNFHVGNPQAWFNQSFER(process); +} +extern "C" long PHVXRSJHCWRZPBYCODZDRNLUGBAIWNMDYVPPLZWMYNDQYRLUGKBPGAACWAQPSBLP(IntPtr process); +inline static long System_Diagnostics_Process_PeakWorkingSet64(IntPtr process) +{ + return PHVXRSJHCWRZPBYCODZDRNLUGBAIWNMDYVPPLZWMYNDQYRLUGKBPGAACWAQPSBLP(process); +} +extern "C" bool KNATMJQPHMFDJUWOQGBLLWXYVMTLIHUXCOGKRRIXTMITVXTBDBYLAZEOQBYZPFGA(IntPtr process); +inline static bool System_Diagnostics_Process_PriorityBoostEnabled(IntPtr process) +{ + return KNATMJQPHMFDJUWOQGBLLWXYVMTLIHUXCOGKRRIXTMITVXTBDBYLAZEOQBYZPFGA(process); +} +extern "C" ProcessPriorityClass RIAVOMXYXDRYODCYSSHHIIXDJRUPTIHOFICNWYMRDZNWHFZMYZGXYZRILWLWSIFP(IntPtr process); +inline static ProcessPriorityClass System_Diagnostics_Process_PriorityClass(IntPtr process) +{ + return RIAVOMXYXDRYODCYSSHHIIXDJRUPTIHOFICNWYMRDZNWHFZMYZGXYZRILWLWSIFP(process); +} +extern "C" int VDTGBPBUFPDIVAVDSHQTCKPFQTCZNPZVUYADMSLJYMSIWINKAHEKRMNLONPHNBGP(IntPtr process); +inline static int System_Diagnostics_Process_PrivateMemorySize(IntPtr process) +{ + return VDTGBPBUFPDIVAVDSHQTCKPFQTCZNPZVUYADMSLJYMSIWINKAHEKRMNLONPHNBGP(process); +} +extern "C" long QHOWZRRZVHVPSGJHGSZFLOEILPPYDDWWFCSOUQKIQEOKQXSHEIBVCBDBDGKKCSWS(IntPtr process); +inline static long System_Diagnostics_Process_PrivateMemorySize64(IntPtr process) +{ + return QHOWZRRZVHVPSGJHGSZFLOEILPPYDDWWFCSOUQKIQEOKQXSHEIBVCBDBDGKKCSWS(process); +} +extern "C" TimeSpan KYKPOUNPHQOHZTROWIUUCBUDYQLNGZGYHWZSMCTKULNMMWBJPWOTXBPJDGRXIZJH(IntPtr process); +inline static TimeSpan System_Diagnostics_Process_PrivilegedProcessorTime(IntPtr process) +{ + return KYKPOUNPHQOHZTROWIUUCBUDYQLNGZGYHWZSMCTKULNMMWBJPWOTXBPJDGRXIZJH(process); +} +extern "C" char* JQZDUYBTPKZQNIRCPCYJLNAGHPOGLVBVCFCWXYPQVUDNCYVVPPIGAAWVQTVEJUIT(IntPtr process); +inline static char* System_Diagnostics_Process_ProcessName(IntPtr process) +{ + return JQZDUYBTPKZQNIRCPCYJLNAGHPOGLVBVCFCWXYPQVUDNCYVVPPIGAAWVQTVEJUIT(process); +} +extern "C" IntPtr IEOIFVEQNHNRJNDIUSQWNVUCJHGDCKHAMJFXKNQUKRTTMELCPMKQDLGNJLYXOBNC(IntPtr process); +inline static IntPtr System_Diagnostics_Process_ProcessorAffinity(IntPtr process) +{ + return IEOIFVEQNHNRJNDIUSQWNVUCJHGDCKHAMJFXKNQUKRTTMELCPMKQDLGNJLYXOBNC(process); +} +extern "C" bool AMFAIGYGCWLWCBQFVDOPAQWADRNYPTFJDQSZZLUJOEOHZKKIVTCLMXCKQEWQSZQJ(IntPtr process); +inline static bool System_Diagnostics_Process_Responding(IntPtr process) +{ + return AMFAIGYGCWLWCBQFVDOPAQWADRNYPTFJDQSZZLUJOEOHZKKIVTCLMXCKQEWQSZQJ(process); +} +extern "C" int RCSLIQFJIFBWBPATHFDVQTWFOIJUOERONFQXRZAENSDHWGIAEDJNWUSXFNWAHKVD(IntPtr process); +inline static int System_Diagnostics_Process_SessionId(IntPtr process) +{ + return RCSLIQFJIFBWBPATHFDVQTWFOIJUOERONFQXRZAENSDHWGIAEDJNWUSXFNWAHKVD(process); +} +extern "C" IntPtr NNIWZDCHEYIXPPJIAIQKVESSMSRECZXCXATIXMBBBBIYMVHQDOAYUKHJVQJGLXEF(IntPtr process); +inline static IntPtr System_Diagnostics_Process_StandardError(IntPtr process) +{ + return NNIWZDCHEYIXPPJIAIQKVESSMSRECZXCXATIXMBBBBIYMVHQDOAYUKHJVQJGLXEF(process); +} +extern "C" IntPtr AFZPVALNGOJUWTFRKAAOZZINSJNHCVPDXCXHVSVDCMRGANNBKRVLXPFBXLWLMDKL(IntPtr process); +inline static IntPtr System_Diagnostics_Process_StandardInput(IntPtr process) +{ + return AFZPVALNGOJUWTFRKAAOZZINSJNHCVPDXCXHVSVDCMRGANNBKRVLXPFBXLWLMDKL(process); +} +extern "C" IntPtr YFXTWYWSFXLNHBNFWMXLZEGHXWKJVJQZBFHUQUELUDFADRTVYQPAGZMUZPVZONWW(IntPtr process); +inline static IntPtr System_Diagnostics_Process_StandardOutput(IntPtr process) +{ + return YFXTWYWSFXLNHBNFWMXLZEGHXWKJVJQZBFHUQUELUDFADRTVYQPAGZMUZPVZONWW(process); +} +extern "C" IntPtr GMLCUSPCHLQWYFDFDPKETQSCTNVAYFXHGJTQGRAGBNSVIQVTLPWYCRCQUJIHXODC(IntPtr process); +inline static IntPtr System_Diagnostics_Process_StartInfo(IntPtr process) +{ + return GMLCUSPCHLQWYFDFDPKETQSCTNVAYFXHGJTQGRAGBNSVIQVTLPWYCRCQUJIHXODC(process); +} +extern "C" __DateTime NJPPMNZLOEDGXWTCRBPIIYFOGDWWITJNJQIZAFHYQKKYOWSXQFPVZUUODAIJQDDV(IntPtr process); +inline static __DateTime System_Diagnostics_Process_StartTime(IntPtr process) +{ + return NJPPMNZLOEDGXWTCRBPIIYFOGDWWITJNJQIZAFHYQKKYOWSXQFPVZUUODAIJQDDV(process); +} +extern "C" ThreadInfo * VPWHOUCMUQSXOHAKKYGCDNOPVUVZWXHMHPDYZKJVDDBIBWZWAYZSXARHBHLUYCPW(IntPtr process , int* tlen); +inline static ThreadInfo* System_Diagnostics_Process_Threads(IntPtr process , int* tlen) +{ + return VPWHOUCMUQSXOHAKKYGCDNOPVUVZWXHMHPDYZKJVDDBIBWZWAYZSXARHBHLUYCPW(process , tlen); +} +extern "C" TimeSpan JGPYEBLZPKZALFNZUYZYYPPHYVWSYPWBOFZVHASZNZDMARVVTMZZDQXTQIAIESBZ(IntPtr process); +inline static TimeSpan System_Diagnostics_Process_TotalProcessorTime(IntPtr process) +{ + return JGPYEBLZPKZALFNZUYZYYPPHYVWSYPWBOFZVHASZNZDMARVVTMZZDQXTQIAIESBZ(process); +} +extern "C" TimeSpan NYLGGSSTGALZMCGGZAZLPWXXHFFYZJUUYDZCFOPBUGTCFYHNBUIDTPKQAOZBMTTW(IntPtr process); +inline static TimeSpan System_Diagnostics_Process_UserProcessorTime(IntPtr process) +{ + return NYLGGSSTGALZMCGGZAZLPWXXHFFYZJUUYDZCFOPBUGTCFYHNBUIDTPKQAOZBMTTW(process); +} +extern "C" int FQBIDDBKLXRIDVRIXRWFBQAJSICQPOOBNXXOXYKYSYRVXBNFXRDVWNVOQSPVBKVX(IntPtr process); +inline static int System_Diagnostics_Process_VirtualMemorySize(IntPtr process) +{ + return FQBIDDBKLXRIDVRIXRWFBQAJSICQPOOBNXXOXYKYSYRVXBNFXRDVWNVOQSPVBKVX(process); +} +extern "C" long JPVFXDLYHYMDYFLQVXTYKTEZCIYFJPWICUMIGHHTFEOXASPLHYZDRXNQKVDPEGPS(IntPtr process); +inline static long System_Diagnostics_Process_VirtualMemorySize64(IntPtr process) +{ + return JPVFXDLYHYMDYFLQVXTYKTEZCIYFJPWICUMIGHHTFEOXASPLHYZDRXNQKVDPEGPS(process); +} +extern "C" int BEAESCKNPZSFFHYJSNYKPSQEHWXKDSPZPVWWRLSEOMORFHLDXTWRHFDINWXWFAJX(IntPtr process); +inline static int System_Diagnostics_Process_WorkingSet(IntPtr process) +{ + return BEAESCKNPZSFFHYJSNYKPSQEHWXKDSPZPVWWRLSEOMORFHLDXTWRHFDINWXWFAJX(process); +} +extern "C" long KSQJLCSHVTVCEZYZKTNJVYRJSNIVNVYOCQHNRBSUBOVNJADOXXLMNZBLAGQXUXUZ(IntPtr process); +inline static long System_Diagnostics_Process_WorkingSet64(IntPtr process) +{ + return KSQJLCSHVTVCEZYZKTNJVYRJSNIVNVYOCQHNRBSUBOVNJADOXXLMNZBLAGQXUXUZ(process); +} +extern "C" IntPtr VHAORLIJASIHCDASJTXPKMBCOVMLKVADUWSBAPWLPCLURUJWFYOBZEOJGXZWYXYF(); +inline static IntPtr System_Diagnostics_ProcessStartInfo_New() +{ + return VHAORLIJASIHCDASJTXPKMBCOVMLKVADUWSBAPWLPCLURUJWFYOBZEOJGXZWYXYF(); +} +extern "C" IntPtr SEMFLYRTWMAIAGLTLQFMHYEQIJUCPAMSEGBMIELHHUENEGIALFKIRLYTAVXBDPDW(const char* _filename); +inline static IntPtr System_Diagnostics_ProcessStartInfo_NewI(const char* _filename) +{ + return SEMFLYRTWMAIAGLTLQFMHYEQIJUCPAMSEGBMIELHHUENEGIALFKIRLYTAVXBDPDW(_filename); +} +extern "C" IntPtr ZHDUEZLHEXFMUQMBBURKPDASHILMHJDSQHOWCNVMUDDTGLYJJVAIXTGVGLMWNZAV(const char* _fileName , const char* _arguments); +inline static IntPtr System_Diagnostics_ProcessStartInfo_NewII(const char* _fileName , const char* _arguments) +{ + return ZHDUEZLHEXFMUQMBBURKPDASHILMHJDSQHOWCNVMUDDTGLYJJVAIXTGVGLMWNZAV(_fileName , _arguments); +} +extern "C" IntPtr UNWMCPZNZEPMZHLWJCDLJUUWBSQRBYZVCIZTPMGTWMJTDUVZAQNKWOLZSZLKZIMA(IntPtr info); +inline static IntPtr System_Diagnostics_ProcessStartInfo_GetFileName(IntPtr info) +{ + return UNWMCPZNZEPMZHLWJCDLJUUWBSQRBYZVCIZTPMGTWMJTDUVZAQNKWOLZSZLKZIMA(info); +} +extern "C" void FUKRHRHWVJPWLASHWQRKLOZNWZAPAWUNAIOIKERIJQPMYPOSHENIRBPQVWUIQRWY(IntPtr info , const char* filename); +inline static void System_Diagnostics_ProcessStartInfo_SetFileName(IntPtr info , const char* filename) +{ + FUKRHRHWVJPWLASHWQRKLOZNWZAPAWUNAIOIKERIJQPMYPOSHENIRBPQVWUIQRWY(info , filename); +} +extern "C" char* OBVCMJXSZIBUYMOHLIIWILWZTXNNKJRRUQXXTMFXHVJIZUSJHMWIJZPDFWIPWJIP(IntPtr info); +inline static char* System_Diagnostics_ProcessStartInfo_GetArguments(IntPtr info) +{ + return OBVCMJXSZIBUYMOHLIIWILWZTXNNKJRRUQXXTMFXHVJIZUSJHMWIJZPDFWIPWJIP(info); +} +extern "C" void QKAIOROZCLPNCOZZEEGXMJHVAURWDQAYNTSOTKUPYXFYJCARWJKSCKCGDFHUZRVM(IntPtr info , const char* Arguments); +inline static void System_Diagnostics_ProcessStartInfo_SetArguments(IntPtr info , const char* Arguments) +{ + QKAIOROZCLPNCOZZEEGXMJHVAURWDQAYNTSOTKUPYXFYJCARWJKSCKCGDFHUZRVM(info , Arguments); +} +extern "C" bool KRAJWLFUJRZPEILYTAZUGIVCQLLOCAPGBSOSCRULDPILLNCUUIAYRBGBVXSKZRRJ(IntPtr info); +inline static bool System_Diagnostics_ProcessStartInfo_GetCreateNoWindow(IntPtr info) +{ + return KRAJWLFUJRZPEILYTAZUGIVCQLLOCAPGBSOSCRULDPILLNCUUIAYRBGBVXSKZRRJ(info); +} +extern "C" void BSNLUTWCFOQQAKRCIRUUAQOZMMWEZKMMXYJSZQZAMYTDLPBLFPBHWXJKEOZIWRCV(IntPtr info , bool CreateNoWindow); +inline static void System_Diagnostics_ProcessStartInfo_SetCreateNoWindow(IntPtr info , bool CreateNoWindow) +{ + BSNLUTWCFOQQAKRCIRUUAQOZMMWEZKMMXYJSZQZAMYTDLPBLFPBHWXJKEOZIWRCV(info , CreateNoWindow); +} +extern "C" bool BDSBAZDSSTIBXLOXKKZJIEPZPYNLRQEUVXBHWAKFMJPDPHNTABXLSTNXNTLCLRAB(IntPtr info); +inline static bool System_Diagnostics_ProcessStartInfo_GetUseShellExecute(IntPtr info) +{ + return BDSBAZDSSTIBXLOXKKZJIEPZPYNLRQEUVXBHWAKFMJPDPHNTABXLSTNXNTLCLRAB(info); +} +extern "C" void PNGAJGAKATWYOMKILULPTSBBJETDOIUUIOOBAMJTBNLZWOIBIDQQGLHWMEQEMWWR(IntPtr info , bool UseShellExecute); +inline static void System_Diagnostics_ProcessStartInfo_SetUseShellExecute(IntPtr info , bool UseShellExecute) +{ + PNGAJGAKATWYOMKILULPTSBBJETDOIUUIOOBAMJTBNLZWOIBIDQQGLHWMEQEMWWR(info , UseShellExecute); +} +extern "C" bool YBPAYIHYKROFHBFUVSUKRDOXGRPVVFGEQTAVZICAVRGOXCOKZWIUBLZVMSTGTMCF(IntPtr info); +inline static bool System_Diagnostics_ProcessStartInfo_GetRedirectStandardInput(IntPtr info) +{ + return YBPAYIHYKROFHBFUVSUKRDOXGRPVVFGEQTAVZICAVRGOXCOKZWIUBLZVMSTGTMCF(info); +} +extern "C" void LJOOAKVNPUOAXAAECEVZWMDFTFIGPWGJOACNNAKPAVEGWZYMRODOQDJYGJUVBOXT(IntPtr info , bool RedirectStandardInput); +inline static void System_Diagnostics_ProcessStartInfo_SetRedirectStandardInput(IntPtr info , bool RedirectStandardInput) +{ + LJOOAKVNPUOAXAAECEVZWMDFTFIGPWGJOACNNAKPAVEGWZYMRODOQDJYGJUVBOXT(info , RedirectStandardInput); +} +extern "C" bool NFLXXMRCUGZAHWITHVPASSTLQEHDGPNLYLSROAOFWBUKDJRKAANGZWBVLZGTEOWF(IntPtr info); +inline static bool System_Diagnostics_ProcessStartInfo_GetRedirectStandardOutput(IntPtr info) +{ + return NFLXXMRCUGZAHWITHVPASSTLQEHDGPNLYLSROAOFWBUKDJRKAANGZWBVLZGTEOWF(info); +} +extern "C" void SOCWDRFGHJEQXJIHNXDFBHLBJXFOUVAIFOSPHUHIVHYPSKYCRZGHKREKCBMFLRMM(IntPtr info , bool RedirectStandardOutput); +inline static void System_Diagnostics_ProcessStartInfo_SetRedirectStandardOutput(IntPtr info , bool RedirectStandardOutput) +{ + SOCWDRFGHJEQXJIHNXDFBHLBJXFOUVAIFOSPHUHIVHYPSKYCRZGHKREKCBMFLRMM(info , RedirectStandardOutput); +} +extern "C" bool JVKIRTASQUJUJVIYZDWVOTXOKHMGHBXEUMGXAPKYZNQQHJBGSOGHURXQXWXJGUKP(IntPtr info); +inline static bool System_Diagnostics_ProcessStartInfo_GetRedirectStandardError(IntPtr info) +{ + return JVKIRTASQUJUJVIYZDWVOTXOKHMGHBXEUMGXAPKYZNQQHJBGSOGHURXQXWXJGUKP(info); +} +extern "C" void WFZWPLYJTYVACHHBGFNTUPJDPPZDRASFCBTBKERGPXOWVWOQPWDAGRVHVVHALUSS(IntPtr info , bool RedirectStandardError); +inline static void System_Diagnostics_ProcessStartInfo_SetRedirectStandardError(IntPtr info , bool RedirectStandardError) +{ + WFZWPLYJTYVACHHBGFNTUPJDPPZDRASFCBTBKERGPXOWVWOQPWDAGRVHVVHALUSS(info , RedirectStandardError); +} +extern "C" bool GQXBNFQBOGDXANISBJOUXRYLFMFOXRVUEVPEYMCJFBMZOYGINOYCGXVPRMVBZCEX(IntPtr info); +inline static bool System_Diagnostics_ProcessStartInfo_GetLoadUserProfile(IntPtr info) +{ + return GQXBNFQBOGDXANISBJOUXRYLFMFOXRVUEVPEYMCJFBMZOYGINOYCGXVPRMVBZCEX(info); +} +extern "C" void LISFXDTOGFPVEZXHFXBISSOGAAMLRBJDXPOFFBKJVKWBIZKSPOVCAVESULEWRHXE(IntPtr info , bool LoadUserProfile); +inline static void System_Diagnostics_ProcessStartInfo_SetLoadUserProfile(IntPtr info , bool LoadUserProfile) +{ + LISFXDTOGFPVEZXHFXBISSOGAAMLRBJDXPOFFBKJVKWBIZKSPOVCAVESULEWRHXE(info , LoadUserProfile); +} +extern "C" char* VLYPKSBDMSNHWMYBQTWCGGDCKVKTXOSNNRFXAUIXMRQHHWWHNCGXLUYOIWEPHHGY(IntPtr info); +inline static char* System_Diagnostics_ProcessStartInfo_GetUserName(IntPtr info) +{ + return VLYPKSBDMSNHWMYBQTWCGGDCKVKTXOSNNRFXAUIXMRQHHWWHNCGXLUYOIWEPHHGY(info); +} +extern "C" void AAUEHBAVLYQOQVUNYCGUIUBSTRPEQSPEKRHHCSAMBKLMDJXMBRREBLQFYBKQLWFT(IntPtr info , const char* UserName); +inline static void System_Diagnostics_ProcessStartInfo_SetUserName(IntPtr info , const char* UserName) +{ + AAUEHBAVLYQOQVUNYCGUIUBSTRPEQSPEKRHHCSAMBKLMDJXMBRREBLQFYBKQLWFT(info , UserName); +} +extern "C" IntPtr IMDYNNLFCUTXJPPKTCDYBKDZBBIAHKAFESDRGYYNFLCGSSWJMAWJTGRYJEXLFLXS(IntPtr info); +inline static IntPtr System_Diagnostics_ProcessStartInfo_GetVerb(IntPtr info) +{ + return IMDYNNLFCUTXJPPKTCDYBKDZBBIAHKAFESDRGYYNFLCGSSWJMAWJTGRYJEXLFLXS(info); +} +extern "C" void TNTRLXEUDPTQIWGJFZNHNQLYAFIBBNIUNKNFZFXPWCGENBPMYNGFXQECBURGPCTQ(IntPtr info , const char* Verb); +inline static void System_Diagnostics_ProcessStartInfo_SetVerb(IntPtr info , const char* Verb) +{ + TNTRLXEUDPTQIWGJFZNHNQLYAFIBBNIUNKNFZFXPWCGENBPMYNGFXQECBURGPCTQ(info , Verb); +} +extern "C" ProcessWindowStyle GYCXJBKACYKLKHKYPVDOGDWWFKDEORZUJPXOYRDWDGDYFTSTJSQTZFJDBGSYXGLK(IntPtr info); +inline static ProcessWindowStyle System_Diagnostics_ProcessStartInfo_GetWindowStyle(IntPtr info) +{ + return GYCXJBKACYKLKHKYPVDOGDWWFKDEORZUJPXOYRDWDGDYFTSTJSQTZFJDBGSYXGLK(info); +} +extern "C" void YQCVJWZXRGKAZYQMSJUVAGVEFUMSZEZWUSAPRWKNTSBSUJDDPFGOLQKSVXPPJHYN(IntPtr info , ProcessWindowStyle WindowStyle); +inline static void System_Diagnostics_ProcessStartInfo_SetWindowStyle(IntPtr info , ProcessWindowStyle WindowStyle) +{ + YQCVJWZXRGKAZYQMSJUVAGVEFUMSZEZWUSAPRWKNTSBSUJDDPFGOLQKSVXPPJHYN(info , WindowStyle); +} +extern "C" IntPtr HNFGXBUVZGCIECKVQJCTYKLEIHTTHUDMUOKGEXFOLLOENCNSNTYAEEOWCBYQHBOE(); +inline static IntPtr System_Random_New() +{ + return HNFGXBUVZGCIECKVQJCTYKLEIHTTHUDMUOKGEXFOLLOENCNSNTYAEEOWCBYQHBOE(); +} +extern "C" IntPtr CQNQRDRTDNIMVGQGUAFNVDHQZODDYPHKXKBXOXBJBFXQVCBVKSVGVAJZIXQDAOUN(int max); +inline static IntPtr System_Random_NewI(int max) +{ + return CQNQRDRTDNIMVGQGUAFNVDHQZODDYPHKXKBXOXBJBFXQVCBVKSVGVAJZIXQDAOUN(max); +} +extern "C" int GYPLETRXZVMQGRVXNHSGTAOXACORGXJNKJJWMPRRBYGZOTTRCTQSWOTGJSKCEZQB(IntPtr _r); +inline static int System_Random_NextI(IntPtr _r) +{ + return GYPLETRXZVMQGRVXNHSGTAOXACORGXJNKJJWMPRRBYGZOTTRCTQSWOTGJSKCEZQB(_r); +} +extern "C" int MYFWHYKXQAEVTPIHIWPNHQRVPDMUEONBHFMPNWKDJSCVJYMUJCTHKDUVHJGDLPTB(IntPtr _r , int max); +inline static int System_Random_NextII(IntPtr _r , int max) +{ + return MYFWHYKXQAEVTPIHIWPNHQRVPDMUEONBHFMPNWKDJSCVJYMUJCTHKDUVHJGDLPTB(_r , max); +} +extern "C" int NDNOCTUMMLDOOVMRRSLBUFQEKRHEPGSTZAHGLXRPIHVZZFHMXPMSERHINIELMQWF(IntPtr _r , int min , int max); +inline static int System_Random_NextIII(IntPtr _r , int min , int max) +{ + return NDNOCTUMMLDOOVMRRSLBUFQEKRHEPGSTZAHGLXRPIHVZZFHMXPMSERHINIELMQWF(_r , min , max); +} +extern "C" double SKPNOGGTAVTNKREEJVGZTZPITYSCTGDSKPGPQUXRJTSIYTXWEZCRJWLTUHTPNEZU(IntPtr _r); +inline static double System_Random_NextDouble(IntPtr _r) +{ + return SKPNOGGTAVTNKREEJVGZTZPITYSCTGDSKPGPQUXRJTSIYTXWEZCRJWLTUHTPNEZU(_r); +} +extern "C" BYTE * SACVKPOOXPQAHGJABWXUEMJODNUJAHDFTYQXQCLPKNTTGLLOXTOQGFPGRORXUFOQ(IntPtr _r , int len); +inline static BYTE* System_Random_NextBytes(IntPtr _r , int len) +{ + return SACVKPOOXPQAHGJABWXUEMJODNUJAHDFTYQXQCLPKNTTGLLOXTOQGFPGRORXUFOQ(_r , len); +} +extern "C" void MLGJPMJYLIJQSPHSBGLGSNZOIKGCLOUFZDHVECYLKQFXVYNBGZVOTHXYMSBFFHNX(const char* _text , const char* _pattem , const char*** outtmp , int* counttmp); +inline static void System_Text_RegularExpressions_Regex_Matches(const char* _text , const char* _pattem , const char*** outtmp , int* counttmp) +{ + MLGJPMJYLIJQSPHSBGLGSNZOIKGCLOUFZDHVECYLKQFXVYNBGZVOTHXYMSBFFHNX(_text , _pattem , outtmp , counttmp); +} +extern "C" void JFPMZFEVTPYLLQMUFYYXEZOCNBOMBZSIXQFDDGVQEEPDXDMUJLGKYORJRNYYRSUU(const char* _text , const char* _pattem , const char*** outtmp , int* counttmp); +inline static void System_Text_RegularExpressions_Regex_Slpite(const char* _text , const char* _pattem , const char*** outtmp , int* counttmp) +{ + JFPMZFEVTPYLLQMUFYYXEZOCNBOMBZSIXQFDDGVQEEPDXDMUJLGKYORJRNYYRSUU(_text , _pattem , outtmp , counttmp); +} +extern "C" char* XPOVKJRYCITAKKEKOUCPTHJIYVLPIXYLKVGHPRJZTHHQVRZGJOJXPEBPGFWOXBQE(const char* _text , const char* _pattem , const char* _replacement); +inline static char* System_Text_RegularExpressions_Regex_Replace(const char* _text , const char* _pattem , const char* _replacement) +{ + return XPOVKJRYCITAKKEKOUCPTHJIYVLPIXYLKVGHPRJZTHHQVRZGJOJXPEBPGFWOXBQE(_text , _pattem , _replacement); +} +extern "C" IntPtr NERPHMOZHAWCIBSJXEVLTGLSFIILBTFDCIJRHXUTLVGTKUQKARIBMBDHSZJZDCYO(); +inline static IntPtr System_Diagnostics_Stopwatch_StartNew() +{ + return NERPHMOZHAWCIBSJXEVLTGLSFIILBTFDCIJRHXUTLVGTKUQKARIBMBDHSZJZDCYO(); +} +extern "C" TimeSpan UTZZRBCZKBAXZSHKSYLJKDRBECYHNUQIWSYRVQTZOIRKAGIASZHFRPDQCYVPCULP(IntPtr stp); +inline static TimeSpan System_Diagnostics_Stopwatch_Elapsed(IntPtr stp) +{ + return UTZZRBCZKBAXZSHKSYLJKDRBECYHNUQIWSYRVQTZOIRKAGIASZHFRPDQCYVPCULP(stp); +} +extern "C" void LSBGTPPBEMUCMGAXTXPONKQHPHPWUEWTXCZIFBGCJFBFUBEVYXVFFWBABTRMATGA(IntPtr stp); +inline static void System_Diagnostics_Stopwatch_Stop(IntPtr stp) +{ + LSBGTPPBEMUCMGAXTXPONKQHPHPWUEWTXCZIFBGCJFBFUBEVYXVFFWBABTRMATGA(stp); +} +extern "C" void PAFKGRSRRNFHJLNODTYXIQOAAYHLKUBPZAPTWTPGEDOSRURPGDIHVJRZMEKHJHHW(IntPtr stp); +inline static void System_Diagnostics_Stopwatch_Restart(IntPtr stp) +{ + PAFKGRSRRNFHJLNODTYXIQOAAYHLKUBPZAPTWTPGEDOSRURPGDIHVJRZMEKHJHHW(stp); +} +extern "C" IntPtr LPIIVTRJDRSECVJGGSFGLTUQIQGRJHXXWRHBLJTMLZDDQNWRVDBRBALRVRZFNAAW(); +inline static IntPtr System_IO_Stream_Null() +{ + return LPIIVTRJDRSECVJGGSFGLTUQIQGRJHXXWRHBLJTMLZDDQNWRVDBRBALRVRZFNAAW(); +} +extern "C" bool UUHLOHUXYTVMPRZVTPVFGFWVGPGUKOYLZHJWFLCNJDTHFZCESELXEUPOXLEZBANK(IntPtr stream); +inline static bool System_IO_Stream_CanRead(IntPtr stream) +{ + return UUHLOHUXYTVMPRZVTPVFGFWVGPGUKOYLZHJWFLCNJDTHFZCESELXEUPOXLEZBANK(stream); +} +extern "C" bool UJMIHCPINHVCMOQHMCCGCBGERUYTGDMJQIMVMUWPODKWYNCJVXMZXHITCIQNEWBK(IntPtr stream); +inline static bool System_IO_Stream_CanSeek(IntPtr stream) +{ + return UJMIHCPINHVCMOQHMCCGCBGERUYTGDMJQIMVMUWPODKWYNCJVXMZXHITCIQNEWBK(stream); +} +extern "C" bool VMLEBVVSFNRZRKGESPYIQNLJATSDDJKSBZBMBYHACTTKPIBSCLUPXTTIACDICRPW(IntPtr stream); +inline static bool System_IO_Stream_CanTimeout(IntPtr stream) +{ + return VMLEBVVSFNRZRKGESPYIQNLJATSDDJKSBZBMBYHACTTKPIBSCLUPXTTIACDICRPW(stream); +} +extern "C" bool CZXRJUDUIXGXTAURSZBROVUIGSLZUZXLEWIQKJJIIZHZMVOZIMPCPXIGEPKQIDAI(IntPtr stream); +inline static bool System_IO_Stream_CanWrite(IntPtr stream) +{ + return CZXRJUDUIXGXTAURSZBROVUIGSLZUZXLEWIQKJJIIZHZMVOZIMPCPXIGEPKQIDAI(stream); +} +extern "C" long AUTWSEGIQTIOOUVLDLQIJVWGOBLVYSZEZYZRCRHDFHMVOTSKUZMWNRZEYMIQTLJX(IntPtr stream); +inline static long System_IO_Stream_Length(IntPtr stream) +{ + return AUTWSEGIQTIOOUVLDLQIJVWGOBLVYSZEZYZRCRHDFHMVOTSKUZMWNRZEYMIQTLJX(stream); +} +extern "C" long UDPQUDIMEMCCJASVJAAYGCRHZVTQJQKTXOAKEBQQRASAOWVXTMHSKKQSLHRZKSCN(IntPtr stream); +inline static long System_IO_Stream_GetPosition(IntPtr stream) +{ + return UDPQUDIMEMCCJASVJAAYGCRHZVTQJQKTXOAKEBQQRASAOWVXTMHSKKQSLHRZKSCN(stream); +} +extern "C" void CIEUZHRHKJHFJRSCZVWXJSJMXIYWKRGZYEYFSAXMVZIADLIUOOZOVFEJZRWQIUXT(IntPtr stream , long position); +inline static void System_IO_Stream_SetPosition(IntPtr stream , long position) +{ + CIEUZHRHKJHFJRSCZVWXJSJMXIYWKRGZYEYFSAXMVZIADLIUOOZOVFEJZRWQIUXT(stream , position); +} +extern "C" int DIHETNJYXKBJJIJMAEIVRRDTAOGAEGDACPXVDDABEARLDUZRIKQEMBBMEOEFGJUQ(IntPtr stream); +inline static int System_IO_Stream_GetReadTimeout(IntPtr stream) +{ + return DIHETNJYXKBJJIJMAEIVRRDTAOGAEGDACPXVDDABEARLDUZRIKQEMBBMEOEFGJUQ(stream); +} +extern "C" void HBHUKOJXEGQRZSPFOOSUQZNANLROYVUVFADBMFGTASAFKKMLYYRSQAZINHHZXUYJ(IntPtr stream , int ReadTimeout); +inline static void System_IO_Stream_SetReadTimeout(IntPtr stream , int ReadTimeout) +{ + HBHUKOJXEGQRZSPFOOSUQZNANLROYVUVFADBMFGTASAFKKMLYYRSQAZINHHZXUYJ(stream , ReadTimeout); +} +extern "C" int MVLZOOTJHYTXZHPDYFQZDCEFAVNFXGWGUQTPYNWKFIKSHCJGSEAREYFKQGYTANLA(IntPtr stream); +inline static int System_IO_Stream_GetWriteTimeout(IntPtr stream) +{ + return MVLZOOTJHYTXZHPDYFQZDCEFAVNFXGWGUQTPYNWKFIKSHCJGSEAREYFKQGYTANLA(stream); +} +extern "C" void BMDIOZELIFUVRMXYMHMTGFCVLJZRODJRWJQUYBRSZOIYEJSDJZGSBRUWKHWEZMWF(IntPtr stream , int WriteTimeout); +inline static void System_IO_Stream_SetWriteTimeout(IntPtr stream , int WriteTimeout) +{ + BMDIOZELIFUVRMXYMHMTGFCVLJZRODJRWJQUYBRSZOIYEJSDJZGSBRUWKHWEZMWF(stream , WriteTimeout); +} +extern "C" void IVCWYYYTZUUICGWIBDPNNDSKXDADCXVCZTQMJZRXCVPHXXRWJHBNZEDEDSYVXUQC(IntPtr stream , byte * data , int len); +inline static void System_IO_Stream_Write(IntPtr stream , byte* data , int len) +{ + IVCWYYYTZUUICGWIBDPNNDSKXDADCXVCZTQMJZRXCVPHXXRWJHBNZEDEDSYVXUQC(stream , data , len); +} +extern "C" void YRIIPJZBLSKSOKNZMEUUVHCVPMIRBWAIEMIFOIGZIZBGTLPTEYISAWGRPNSDAIAP(IntPtr stream , byte data); +inline static void System_IO_Stream_WriteByte(IntPtr stream , byte data) +{ + YRIIPJZBLSKSOKNZMEUUVHCVPMIRBWAIEMIFOIGZIZBGTLPTEYISAWGRPNSDAIAP(stream , data); +} +extern "C" int SCOCBIKDXUMWFVCEXPMCNHIHGRPBPDYAZMOQWNRWNFUFKKLTKOFLWXBLUGWJSJOU(IntPtr stream); +inline static int System_IO_Stream_ReadByte(IntPtr stream) +{ + return SCOCBIKDXUMWFVCEXPMCNHIHGRPBPDYAZMOQWNRWNFUFKKLTKOFLWXBLUGWJSJOU(stream); +} +extern "C" int WMWSHLIJXPOIMCXVFWRBXNEBLCWPRHEEQAJXOTMYGWNGJTZRIAEVSMWIIUHEPSSP(IntPtr stream , IntPtr buffer , int offset , int len); +inline static int System_IO_Stream_Read(IntPtr stream , IntPtr buffer , int offset , int len) +{ + return WMWSHLIJXPOIMCXVFWRBXNEBLCWPRHEEQAJXOTMYGWNGJTZRIAEVSMWIIUHEPSSP(stream , buffer , offset , len); +} +extern "C" IntPtr KJRLTZHMKSVBZXSRDEGQDJMEDAPTLHJNDXWZBNXISSLARVIKBPALLBMBXNISKNAC(IntPtr ms); +inline static IntPtr System_IO_Stream_FROMMEMORYSTREAM(IntPtr ms) +{ + return KJRLTZHMKSVBZXSRDEGQDJMEDAPTLHJNDXWZBNXISSLARVIKBPALLBMBXNISKNAC(ms); +} +extern "C" IntPtr VCZHWCZLPUURWDQCQWIPXRQEPTKQENSMSDCCKKGGZUDGXDZGRUNDDHIELUSDSIHC(IntPtr stream); +inline static IntPtr System_IO_StreamReader_New(IntPtr stream) +{ + return VCZHWCZLPUURWDQCQWIPXRQEPTKQENSMSDCCKKGGZUDGXDZGRUNDDHIELUSDSIHC(stream); +} +extern "C" IntPtr BHZTBOSGPCPCOJHLTDZKZPIKVYRPSDNQNAFPEGFCCHNASFQBMHJOJWCLYOYCXCNM(IntPtr stream , bool detectEncodingFromByteOrderMarks); +inline static IntPtr System_IO_StreamReader_NewI(IntPtr stream , bool detectEncodingFromByteOrderMarks) +{ + return BHZTBOSGPCPCOJHLTDZKZPIKVYRPSDNQNAFPEGFCCHNASFQBMHJOJWCLYOYCXCNM(stream , detectEncodingFromByteOrderMarks); +} +extern "C" IntPtr PYONERHNXWISCISPHPDLUYHRYURPHCFATBLTRDXUZVQMOJJQWJVHYCRQQXOKARFV(IntPtr stream , IntPtr encoding); +inline static IntPtr System_IO_StreamReader_NewII(IntPtr stream , IntPtr encoding) +{ + return PYONERHNXWISCISPHPDLUYHRYURPHCFATBLTRDXUZVQMOJJQWJVHYCRQQXOKARFV(stream , encoding); +} +extern "C" IntPtr QHYBWYXDRILYHVCOKATYHYBRJVCUPNUIPVVGLIUXLRPQRTIVVZZAYGOSGHSAWDOE(IntPtr stream , IntPtr encoding , bool detectEncodingFromByteOrderMarks); +inline static IntPtr System_IO_StreamReader_NewIII(IntPtr stream , IntPtr encoding , bool detectEncodingFromByteOrderMarks) +{ + return QHYBWYXDRILYHVCOKATYHYBRJVCUPNUIPVVGLIUXLRPQRTIVVZZAYGOSGHSAWDOE(stream , encoding , detectEncodingFromByteOrderMarks); +} +extern "C" IntPtr ODIMZVDCGVNPILAPMGZPOUKIHDADPTBHCLBNKWWZVWTCTYKVHCNPEZQUTZEVVZMM(IntPtr stream , IntPtr encoding , bool detectEncodingFromByteOrderMarks , int buffersize); +inline static IntPtr System_IO_StreamReader_NewIV(IntPtr stream , IntPtr encoding , bool detectEncodingFromByteOrderMarks , int buffersize) +{ + return ODIMZVDCGVNPILAPMGZPOUKIHDADPTBHCLBNKWWZVWTCTYKVHCNPEZQUTZEVVZMM(stream , encoding , detectEncodingFromByteOrderMarks , buffersize); +} +extern "C" IntPtr TFMWJMFQJZTRAHPJTFWNFMDDVHUKRAEWKGIOLNLVXXFEFYTLKVCQDZHHBIBBRUZI(IntPtr stream , IntPtr encoding , bool detectEncodingFromByteOrderMarks , int buffersize , bool leaveOpen); +inline static IntPtr System_IO_StreamReader_NewV(IntPtr stream , IntPtr encoding , bool detectEncodingFromByteOrderMarks , int buffersize , bool leaveOpen) +{ + return TFMWJMFQJZTRAHPJTFWNFMDDVHUKRAEWKGIOLNLVXXFEFYTLKVCQDZHHBIBBRUZI(stream , encoding , detectEncodingFromByteOrderMarks , buffersize , leaveOpen); +} +extern "C" IntPtr VXGTYBXGTBQIGYYWNJAVYOSLZAMCLKECYWJHSAMJYWWCIZBDKEOIUDKGEVUXOUUJ(const char* path); +inline static IntPtr System_IO_StreamReader_NewVI(const char* path) +{ + return VXGTYBXGTBQIGYYWNJAVYOSLZAMCLKECYWJHSAMJYWWCIZBDKEOIUDKGEVUXOUUJ(path); +} +extern "C" IntPtr WNJJPQENWQXBRQCZZISGWWIUMCDWGPUDCNFVPROUAALDFIPOSUYFCNNAFPXMNHHH(const char* path , bool detectEncodingFromByteOrderMarks); +inline static IntPtr System_IO_StreamReader_NewVII(const char* path , bool detectEncodingFromByteOrderMarks) +{ + return WNJJPQENWQXBRQCZZISGWWIUMCDWGPUDCNFVPROUAALDFIPOSUYFCNNAFPXMNHHH(path , detectEncodingFromByteOrderMarks); +} +extern "C" IntPtr WUZDKHJIUXGVKFPDNODLQOAOAEQATBHSTEGLJLDLKPLEHRQZZUZYEVQHTKDGRJPT(const char* path , IntPtr encoding); +inline static IntPtr System_IO_StreamReader_NewVIII(const char* path , IntPtr encoding) +{ + return WUZDKHJIUXGVKFPDNODLQOAOAEQATBHSTEGLJLDLKPLEHRQZZUZYEVQHTKDGRJPT(path , encoding); +} +extern "C" IntPtr QNBFYDUBLSABDWHINQAYBIOXOYRYHXUBARNTPLBVAXMMVPEXDUSBIQRHZEQZLWTN(const char* path , IntPtr encoding , bool detectEncodingFromByteOrderMarks); +inline static IntPtr System_IO_StreamReader_NewX(const char* path , IntPtr encoding , bool detectEncodingFromByteOrderMarks) +{ + return QNBFYDUBLSABDWHINQAYBIOXOYRYHXUBARNTPLBVAXMMVPEXDUSBIQRHZEQZLWTN(path , encoding , detectEncodingFromByteOrderMarks); +} +extern "C" IntPtr XYAMIOTBPFYEVCBZUUUNETTKZGULVBJDDZOWOSPOBQMDRNMWCQFRBGIEFPMCUHGN(const char* path , IntPtr encoding , bool detectEncodingFromByteOrderMarks , int buffersize); +inline static IntPtr System_IO_StreamReader_NewXI(const char* path , IntPtr encoding , bool detectEncodingFromByteOrderMarks , int buffersize) +{ + return XYAMIOTBPFYEVCBZUUUNETTKZGULVBJDDZOWOSPOBQMDRNMWCQFRBGIEFPMCUHGN(path , encoding , detectEncodingFromByteOrderMarks , buffersize); +} +extern "C" void VVAWOELCFFMOGQTMTXJFWSCXQJRYGNUUKYIWMPIXFDLVUUXPWZIWYBRCTDGFNMVS(IntPtr stream); +inline static void System_IO_StreamReader_Close(IntPtr stream) +{ + VVAWOELCFFMOGQTMTXJFWSCXQJRYGNUUKYIWMPIXFDLVUUXPWZIWYBRCTDGFNMVS(stream); +} +extern "C" void KSEIIXZEOLZTGGCVLCCGFXVJHFDJIDKSHTKCQPHZZDHMBYVMALTKKPNMWUBCUQVL(IntPtr stream); +inline static void System_IO_StreamReader_Peek(IntPtr stream) +{ + KSEIIXZEOLZTGGCVLCCGFXVJHFDJIDKSHTKCQPHZZDHMBYVMALTKKPNMWUBCUQVL(stream); +} +extern "C" void BHLNVAEVVCGBQJHJKQIXJZIRGXGVOEFIIWKUMIRAGYOHILWMNRSDIXCBYUHXTJHQ(IntPtr stream); +inline static void System_IO_StreamReader_DiscardBufferedData(IntPtr stream) +{ + BHLNVAEVVCGBQJHJKQIXJZIRGXGVOEFIIWKUMIRAGYOHILWMNRSDIXCBYUHXTJHQ(stream); +} +extern "C" int XYTUZNXCYHRKKBJUBTIWMBAKTIVSBUGWRYJKSCNZUPFBFRRWKMWAAKEWYIAQREBE(IntPtr stream , IntPtr buffer , int index , int count); +inline static int System_IO_StreamReader_Read(IntPtr stream , IntPtr buffer , int index , int count) +{ + return XYTUZNXCYHRKKBJUBTIWMBAKTIVSBUGWRYJKSCNZUPFBFRRWKMWAAKEWYIAQREBE(stream , buffer , index , count); +} +extern "C" char* AUTMSZBYGJCWWZEBRZHOXGWGUMMKCWHPOAALXEELLXTRIHAYDYZSXMGUYMSFNRWJ(IntPtr stream); +inline static char* System_IO_StreamReader_ReadLine(IntPtr stream) +{ + return AUTMSZBYGJCWWZEBRZHOXGWGUMMKCWHPOAALXEELLXTRIHAYDYZSXMGUYMSFNRWJ(stream); +} +extern "C" char* BMIVYTEMUWDAMEYNMNGDXOSBTGMLMZYUBKPWYEAKUMYBJGHUOFTAKSLNTGBSHTAV(IntPtr stream); +inline static char* System_IO_StreamReader_ReadToEnd(IntPtr stream) +{ + return BMIVYTEMUWDAMEYNMNGDXOSBTGMLMZYUBKPWYEAKUMYBJGHUOFTAKSLNTGBSHTAV(stream); +} +extern "C" IntPtr YJYCOCOHMVJLQRSNZSWGGXJJYCCSCHDBLDDAHEFLRLNOIAWCNOTOWUPAZPEMZVEF(IntPtr stream); +inline static IntPtr System_IO_StreamWriter_New(IntPtr stream) +{ + return YJYCOCOHMVJLQRSNZSWGGXJJYCCSCHDBLDDAHEFLRLNOIAWCNOTOWUPAZPEMZVEF(stream); +} +extern "C" IntPtr SIZNOSFUNKPUKUAYFAEOOOFRNCASASMVGHWAAJOVIYBLEUPFOFGZQQRECIZLRNUU(IntPtr stream , IntPtr encoding); +inline static IntPtr System_IO_StreamWriter_NewI(IntPtr stream , IntPtr encoding) +{ + return SIZNOSFUNKPUKUAYFAEOOOFRNCASASMVGHWAAJOVIYBLEUPFOFGZQQRECIZLRNUU(stream , encoding); +} +extern "C" IntPtr YUODYZYWMJGPMTMTNVDUMMEQQRXRKCDVEHMKFMGOHKNHKCRJVFXWJZHMPYMHBGLJ(IntPtr stream , IntPtr encoding , int buffersize); +inline static IntPtr System_IO_StreamWriter_NewII(IntPtr stream , IntPtr encoding , int buffersize) +{ + return YUODYZYWMJGPMTMTNVDUMMEQQRXRKCDVEHMKFMGOHKNHKCRJVFXWJZHMPYMHBGLJ(stream , encoding , buffersize); +} +extern "C" IntPtr FKKEHCNBOPMCYWFOZOVEEHMEAZUHZZMBYECZRNBTSWHUNFNTSYHNKHEYYFEHHFBP(IntPtr stream , IntPtr encoding , int buffersize , bool leaveOpen); +inline static IntPtr System_IO_StreamWriter_NewIII(IntPtr stream , IntPtr encoding , int buffersize , bool leaveOpen) +{ + return FKKEHCNBOPMCYWFOZOVEEHMEAZUHZZMBYECZRNBTSWHUNFNTSYHNKHEYYFEHHFBP(stream , encoding , buffersize , leaveOpen); +} +extern "C" IntPtr CLDUUGWMNCMIZSRUMBPBSZQQZEBLIULMVSRBBTYLBUZIVWYFOKVGQZXCVMUQELDT(const char* path); +inline static IntPtr System_IO_StreamWriter_NewIV(const char* path) +{ + return CLDUUGWMNCMIZSRUMBPBSZQQZEBLIULMVSRBBTYLBUZIVWYFOKVGQZXCVMUQELDT(path); +} +extern "C" IntPtr QZMHAQSSCDAXZIVDFVXYYFWWVPGPYIHPRGSWJRFYRCDMYZCMRQKJOFUKDQLLJDTT(const char* path , bool append); +inline static IntPtr System_IO_StreamWriter_NewV(const char* path , bool append) +{ + return QZMHAQSSCDAXZIVDFVXYYFWWVPGPYIHPRGSWJRFYRCDMYZCMRQKJOFUKDQLLJDTT(path , append); +} +extern "C" IntPtr WKGSQZTOQZGVCJXVMTXIYYBLMHSTFUOOIJQOTJWSWWSPYYITSQYQFLVYJUGIGAIW(const char* path , bool append , IntPtr encoding); +inline static IntPtr System_IO_StreamWriter_NewVI(const char* path , bool append , IntPtr encoding) +{ + return WKGSQZTOQZGVCJXVMTXIYYBLMHSTFUOOIJQOTJWSWWSPYYITSQYQFLVYJUGIGAIW(path , append , encoding); +} +extern "C" IntPtr KRMSSJBCWFLCFMMNZYBPVYJXOSEZDOLWNWEHLPBJOWTZATTWHTJHZTAMIPEAECZI(const char* path , bool append , IntPtr encoding , int buffersize); +inline static IntPtr System_IO_StreamWriter_NewVII(const char* path , bool append , IntPtr encoding , int buffersize) +{ + return KRMSSJBCWFLCFMMNZYBPVYJXOSEZDOLWNWEHLPBJOWTZATTWHTJHZTAMIPEAECZI(path , append , encoding , buffersize); +} +extern "C" void UOOIHFBJXRAZEJWVZHRKEDXUWSYWLAEMWLFMEKOBRZKHSBHZSJBWKPDQQUMPHFYX(IntPtr wr); +inline static void System_IO_StreamWriter_Close(IntPtr wr) +{ + UOOIHFBJXRAZEJWVZHRKEDXUWSYWLAEMWLFMEKOBRZKHSBHZSJBWKPDQQUMPHFYX(wr); +} +extern "C" void NOCSDKQOSPSFTQBUKYDCZHBHIOVJYZUMBMTEYPWISMDUXYXZSRFIBWXFMUKPPGPT(IntPtr wr); +inline static void System_IO_StreamWriter_Flush(IntPtr wr) +{ + NOCSDKQOSPSFTQBUKYDCZHBHIOVJYZUMBMTEYPWISMDUXYXZSRFIBWXFMUKPPGPT(wr); +} +extern "C" void VFDGWXWUCVJMDHKKRVQHTLKFPORDEHTLXKZRVRDVUKGGMLCFKAXTPIAJUXRIFSQV(IntPtr wr , char c); +inline static void System_IO_StreamWriter_WriteChar(IntPtr wr , char c) +{ + VFDGWXWUCVJMDHKKRVQHTLKFPORDEHTLXKZRVRDVUKGGMLCFKAXTPIAJUXRIFSQV(wr , c); +} +extern "C" void BXOTHTPASVMIFETDMMTEJZVPJQWXZUPCUKEPWIXRLXAUVSDQEOWTZMMCBZKRWRAY(IntPtr wr , const char* s); +inline static void System_IO_StreamWriter_Write(IntPtr wr , const char* s) +{ + BXOTHTPASVMIFETDMMTEJZVPJQWXZUPCUKEPWIXRLXAUVSDQEOWTZMMCBZKRWRAY(wr , s); +} +extern "C" void FKNUADGDOCTLZBTQMGTLXWDIYCNWYFVTXCPLEIQAHTEWTACAGTFPYOAIGFWXQJFJ(IntPtr wr , const char* s); +inline static void System_IO_StreamWriter_WriteLine(IntPtr wr , const char* s) +{ + FKNUADGDOCTLZBTQMGTLXWDIYCNWYFVTXCPLEIQAHTEWTACAGTFPYOAIGFWXQJFJ(wr , s); +} +extern "C" bool GZNXMILDQSEESGPXZNQEAGVIBGEZMSJXNUPTMFOXHBYFKVQAQZXDSAIAEFVFEMRY(IntPtr wr); +inline static bool System_IO_StreamWriter_GetAutoFlush(IntPtr wr) +{ + return GZNXMILDQSEESGPXZNQEAGVIBGEZMSJXNUPTMFOXHBYFKVQAQZXDSAIAEFVFEMRY(wr); +} +extern "C" void JGRXQVKUYTWYHPYGQDJNUGFNMPOHKITVJZWDESJUODEZDJSOGPPADEDCBDLBHCKQ(IntPtr wr , bool AutoFlush); +inline static void System_IO_StreamWriter_SetAutoFlush(IntPtr wr , bool AutoFlush) +{ + JGRXQVKUYTWYHPYGQDJNUGFNMPOHKITVJZWDESJUODEZDJSOGPPADEDCBDLBHCKQ(wr , AutoFlush); +} +extern "C" IntPtr ABPITUBXTOYRCFJCWZBVTSSFWTCAHINLSOZCUKVLNRHOGMAVTIFHBPWIJJMZSBQL(); +inline static IntPtr System_Text_StringBuilder_New() +{ + return ABPITUBXTOYRCFJCWZBVTSSFWTCAHINLSOZCUKVLNRHOGMAVTIFHBPWIJJMZSBQL(); +} +extern "C" IntPtr BMYOGHHLEPHCLDZJTGGYDGKDRQSKYVTMBVNTNMPMBTCLHUXFKCGMURHVCVWPOXNJ(const char* _t); +inline static IntPtr System_Text_StringBuilder_NewI(const char* _t) +{ + return BMYOGHHLEPHCLDZJTGGYDGKDRQSKYVTMBVNTNMPMBTCLHUXFKCGMURHVCVWPOXNJ(_t); +} +extern "C" void WVBPQFWHQUXKDYVXTNZVOGRJOSRRPZXEFTPLSHOFFZVZUXRDZZVBXRUPERAXOERR(IntPtr _sb , const char* s); +inline static void System_Text_StringBuilder_Append(IntPtr _sb , const char* s) +{ + WVBPQFWHQUXKDYVXTNZVOGRJOSRRPZXEFTPLSHOFFZVZUXRDZZVBXRUPERAXOERR(_sb , s); +} +extern "C" void XTEKIKELYUQPLSPQANSQDWGNZAHBHQQAHEBASHVPUJCCBEDLCJXBMBNBMQLICDEH(IntPtr _sb , const char* s); +inline static void System_Text_StringBuilder_AppendLine(IntPtr _sb , const char* s) +{ + XTEKIKELYUQPLSPQANSQDWGNZAHBHQQAHEBASHVPUJCCBEDLCJXBMBNBMQLICDEH(_sb , s); +} +extern "C" void EPIHQOYTRCWUTEMUWWYXTOOGRAOCWMNQFUYMWWUNLDJKETHIEQLGEHNPBBQQZWXF(IntPtr _sb , int index , const char* s); +inline static void System_Text_StringBuilder_Insert(IntPtr _sb , int index , const char* s) +{ + EPIHQOYTRCWUTEMUWWYXTOOGRAOCWMNQFUYMWWUNLDJKETHIEQLGEHNPBBQQZWXF(_sb , index , s); +} +extern "C" int PFOYFAYABKLQFEBXSGXFAGLXHJLUFENPFEUZEICDSLFTWXJWASYTYREIURRWPDUW(IntPtr _sb); +inline static int System_Text_StringBuilder_GetLength(IntPtr _sb) +{ + return PFOYFAYABKLQFEBXSGXFAGLXHJLUFENPFEUZEICDSLFTWXJWASYTYREIURRWPDUW(_sb); +} +extern "C" void XVLBJCTJDTNPBRBKZOUNGURNZMENRGOPQIWALINXYOQEEOGCPHWAIHQCEXBXXGSX(IntPtr _sb , int len); +inline static void System_Text_StringBuilder_SetLength(IntPtr _sb , int len) +{ + XVLBJCTJDTNPBRBKZOUNGURNZMENRGOPQIWALINXYOQEEOGCPHWAIHQCEXBXXGSX(_sb , len); +} +extern "C" void FYZTUAYQAXOREMJKFCXJJNGIRUVOHQZSWSZGPNHPJGALTYYROQRVJINRRRBAEJJK(IntPtr _sb); +inline static void System_Text_StringBuilder_Clear(IntPtr _sb) +{ + FYZTUAYQAXOREMJKFCXJJNGIRUVOHQZSWSZGPNHPJGALTYYROQRVJINRRRBAEJJK(_sb); +} +extern "C" char* XVVLNCVSUHZDNVOSVEARYEINFIOYLGKZWPNYDNDLVZABJKDWCIFAJSLTMHGFOWGN(IntPtr _sb); +inline static char* System_Text_StringBuilder_ToString(IntPtr _sb) +{ + return XVVLNCVSUHZDNVOSVEARYEINFIOYLGKZWPNYDNDLVZABJKDWCIFAJSLTMHGFOWGN(_sb); +} +extern "C" IntPtr XZGYIQOIAOVZDHEVERVCBJQEETLWGYWYSMDJDFOMTXAUWLPFCLAWBEMOJBTOFSBC(); +inline static IntPtr System_Drawing_Pens_Transparent() +{ + return XZGYIQOIAOVZDHEVERVCBJQEETLWGYWYSMDJDFOMTXAUWLPFCLAWBEMOJBTOFSBC(); +} +extern "C" IntPtr SXHRDVRZDJIEJVISEFTVXAWNZPABLAHBWYCYEYCHTBSSVIENSBJZYFERATRNVQND(); +inline static IntPtr System_Drawing_Pens_AliceBlue() +{ + return SXHRDVRZDJIEJVISEFTVXAWNZPABLAHBWYCYEYCHTBSSVIENSBJZYFERATRNVQND(); +} +extern "C" IntPtr BHILTKNGDMCVHERRLMIJQHCQTKXKGOMDNPQOATUINDWMDIKWBZCIHEMTERRIMCZO(); +inline static IntPtr System_Drawing_Pens_AntiqueWhite() +{ + return BHILTKNGDMCVHERRLMIJQHCQTKXKGOMDNPQOATUINDWMDIKWBZCIHEMTERRIMCZO(); +} +extern "C" IntPtr ZYIRODRRSAVNLQNKABIGLDWJCWKIBLWLDHMEASHYIKPHIZIOEHHLTSDVCYPRSIQG(); +inline static IntPtr System_Drawing_Pens_Aqua() +{ + return ZYIRODRRSAVNLQNKABIGLDWJCWKIBLWLDHMEASHYIKPHIZIOEHHLTSDVCYPRSIQG(); +} +extern "C" IntPtr EKJEDIKHTKYAOOBCOVETDKRKERBBDPGZUJDXQDLVXARJUCHNXMDWEWCTTYAMGIEE(); +inline static IntPtr System_Drawing_Pens_Aquamarine() +{ + return EKJEDIKHTKYAOOBCOVETDKRKERBBDPGZUJDXQDLVXARJUCHNXMDWEWCTTYAMGIEE(); +} +extern "C" IntPtr EYGELDMKKIWDTHQBJOEQMJVXGKDRDYPPVNFVVDBTZTMWZZZMHYCSDNRUDIYBZVGL(); +inline static IntPtr System_Drawing_Pens_Azure() +{ + return EYGELDMKKIWDTHQBJOEQMJVXGKDRDYPPVNFVVDBTZTMWZZZMHYCSDNRUDIYBZVGL(); +} +extern "C" IntPtr SHIGBVGGMKRSXYXHKRJEVXLHVKRNFATEMADSQSLMSWFTWZXFKQQILBQVWALQDSBL(); +inline static IntPtr System_Drawing_Pens_Beige() +{ + return SHIGBVGGMKRSXYXHKRJEVXLHVKRNFATEMADSQSLMSWFTWZXFKQQILBQVWALQDSBL(); +} +extern "C" IntPtr QMGXUFQRGWMZRRKWNMCOJLSKJIWQHUJZVTCKSAKFZYCPPREEPPDQQMCFUWNMJAKL(); +inline static IntPtr System_Drawing_Pens_Bisque() +{ + return QMGXUFQRGWMZRRKWNMCOJLSKJIWQHUJZVTCKSAKFZYCPPREEPPDQQMCFUWNMJAKL(); +} +extern "C" IntPtr NMDXPADMCWOKIDUSDRARRTJJRWPWNYWZOQBCNGOOMROTXRXRBUIRZSUTDUFTLGYE(); +inline static IntPtr System_Drawing_Pens_Black() +{ + return NMDXPADMCWOKIDUSDRARRTJJRWPWNYWZOQBCNGOOMROTXRXRBUIRZSUTDUFTLGYE(); +} +extern "C" IntPtr APWSBSFXCMFAFPLZZYVTPEAVVHZTAVDFSKSIVEPJPLPNMUONIGTMLFOWPBWTSLWG(); +inline static IntPtr System_Drawing_Pens_BlanchedAlmond() +{ + return APWSBSFXCMFAFPLZZYVTPEAVVHZTAVDFSKSIVEPJPLPNMUONIGTMLFOWPBWTSLWG(); +} +extern "C" IntPtr IAHVXDEUIMEEPMIBTLKUBRTNVWSUHWQDPIFMMTQEBZDZBJHCSVAHABFQGUZAKKMM(); +inline static IntPtr System_Drawing_Pens_Blue() +{ + return IAHVXDEUIMEEPMIBTLKUBRTNVWSUHWQDPIFMMTQEBZDZBJHCSVAHABFQGUZAKKMM(); +} +extern "C" IntPtr VAPHHVOZUGSCNULLOQBMVIDNCOFSUQTRMQDAUAUWGBNUICDMINLUIARNXBETQWEE(); +inline static IntPtr System_Drawing_Pens_BlueViolet() +{ + return VAPHHVOZUGSCNULLOQBMVIDNCOFSUQTRMQDAUAUWGBNUICDMINLUIARNXBETQWEE(); +} +extern "C" IntPtr MAQWRLROVEFUVIFAKTJHEZJLZPDTVAGKWJIHMGUXWWZDUWSOVDIWMXZMREXBHXSU(); +inline static IntPtr System_Drawing_Pens_Brown() +{ + return MAQWRLROVEFUVIFAKTJHEZJLZPDTVAGKWJIHMGUXWWZDUWSOVDIWMXZMREXBHXSU(); +} +extern "C" IntPtr YVXLAXNEYMLHAFQCXPXSRJXZJVQIJTQYDEEZZGNYPEXAMSMLNUDRAACOXYCEHFUF(); +inline static IntPtr System_Drawing_Pens_BurlyWood() +{ + return YVXLAXNEYMLHAFQCXPXSRJXZJVQIJTQYDEEZZGNYPEXAMSMLNUDRAACOXYCEHFUF(); +} +extern "C" IntPtr VMDVARDRBZCNMWMQIEUPQYXDBQBADJRKJSEZPRKWQLQBYPCBMMWCLFPXPATKPCOS(); +inline static IntPtr System_Drawing_Pens_CadetBlue() +{ + return VMDVARDRBZCNMWMQIEUPQYXDBQBADJRKJSEZPRKWQLQBYPCBMMWCLFPXPATKPCOS(); +} +extern "C" IntPtr ISDTRNBRTYYEIWEMNAORNOYEDHKPXAHOXXTGLIJYKEIMHLPSVHWOOWFTTZQKCMUT(); +inline static IntPtr System_Drawing_Pens_Chartreuse() +{ + return ISDTRNBRTYYEIWEMNAORNOYEDHKPXAHOXXTGLIJYKEIMHLPSVHWOOWFTTZQKCMUT(); +} +extern "C" IntPtr RKGKDYAFRPGIFLWSSRTPDSZBSZMMSZWYKOVXEFPXHRXYPWNHCYSLTEQYKERDLNMR(); +inline static IntPtr System_Drawing_Pens_Chocolate() +{ + return RKGKDYAFRPGIFLWSSRTPDSZBSZMMSZWYKOVXEFPXHRXYPWNHCYSLTEQYKERDLNMR(); +} +extern "C" IntPtr TIYQQZNMCVILVALWLFKUHKFFYXMANLMTFFFHXWRCKFJXWFDJTUSFCSKIDSSTMNZQ(); +inline static IntPtr System_Drawing_Pens_Coral() +{ + return TIYQQZNMCVILVALWLFKUHKFFYXMANLMTFFFHXWRCKFJXWFDJTUSFCSKIDSSTMNZQ(); +} +extern "C" IntPtr IOGPVEYONHJCBHJSTDGSTGQMVXDFEYPXGSOHYNOOWDSVJIGVJZZJGGXCXTUYATKP(); +inline static IntPtr System_Drawing_Pens_CornflowerBlue() +{ + return IOGPVEYONHJCBHJSTDGSTGQMVXDFEYPXGSOHYNOOWDSVJIGVJZZJGGXCXTUYATKP(); +} +extern "C" IntPtr RMWJSBUFOSWPOVDMQIWEYGQZVMKFTQODTDDWMXCHFTVOKHNBQHHSXGQLVWOGROMX(); +inline static IntPtr System_Drawing_Pens_Cornsilk() +{ + return RMWJSBUFOSWPOVDMQIWEYGQZVMKFTQODTDDWMXCHFTVOKHNBQHHSXGQLVWOGROMX(); +} +extern "C" IntPtr DSWLSGASFOYFKCPNYIPLIWGMMRBPJWPQGXKRLCJJHOMIHKBTHAIJZBPHMJYBFKJI(); +inline static IntPtr System_Drawing_Pens_Crimson() +{ + return DSWLSGASFOYFKCPNYIPLIWGMMRBPJWPQGXKRLCJJHOMIHKBTHAIJZBPHMJYBFKJI(); +} +extern "C" IntPtr ZHYNRXCVZFDUJYFBQHIIOGREIDFBDHDWEDJZMNCJYMKUYVYOEWLXCBUTQTENSARR(); +inline static IntPtr System_Drawing_Pens_Cyan() +{ + return ZHYNRXCVZFDUJYFBQHIIOGREIDFBDHDWEDJZMNCJYMKUYVYOEWLXCBUTQTENSARR(); +} +extern "C" IntPtr CGPFOFPCFYJBVWGNFQXHWGUDJQJSJORXUSSRFSZYHJRDRTXTNRIBDKVVLLWYWXSR(); +inline static IntPtr System_Drawing_Pens_DarkBlue() +{ + return CGPFOFPCFYJBVWGNFQXHWGUDJQJSJORXUSSRFSZYHJRDRTXTNRIBDKVVLLWYWXSR(); +} +extern "C" IntPtr HLGCEPHMRYZMORLPSPFRGPUKXWFUWACJQAVFMUOXKVKEKIHUAGGGSBLSRWEIJNQQ(); +inline static IntPtr System_Drawing_Pens_DarkCyan() +{ + return HLGCEPHMRYZMORLPSPFRGPUKXWFUWACJQAVFMUOXKVKEKIHUAGGGSBLSRWEIJNQQ(); +} +extern "C" IntPtr WQWNVFDXAHHKEQZPOLTPUVROPDOQPGNXFUHUMTYUDIGKUANAWPUYTAVBYHXSQMIU(); +inline static IntPtr System_Drawing_Pens_DarkGoldenrod() +{ + return WQWNVFDXAHHKEQZPOLTPUVROPDOQPGNXFUHUMTYUDIGKUANAWPUYTAVBYHXSQMIU(); +} +extern "C" IntPtr UKEJIFDUMZMMOHUPPNTALODFZGVEWGEQALQKWESRMZLUNIMRNICCTHIFGYJBJYYG(); +inline static IntPtr System_Drawing_Pens_DarkGray() +{ + return UKEJIFDUMZMMOHUPPNTALODFZGVEWGEQALQKWESRMZLUNIMRNICCTHIFGYJBJYYG(); +} +extern "C" IntPtr UVMDQKSLVBNMDJRRTERNDBXSDLEXUQINAEZSVJACPRHRUWBXGSHEHLDTYUAFGVQE(); +inline static IntPtr System_Drawing_Pens_DarkGreen() +{ + return UVMDQKSLVBNMDJRRTERNDBXSDLEXUQINAEZSVJACPRHRUWBXGSHEHLDTYUAFGVQE(); +} +extern "C" IntPtr SZLYJZVKDOXLUFXGJGQCIDGPBFUBJVWUBCZUKDNHXXBSNSZSWTWZEOWPTVXDETBI(); +inline static IntPtr System_Drawing_Pens_DarkKhaki() +{ + return SZLYJZVKDOXLUFXGJGQCIDGPBFUBJVWUBCZUKDNHXXBSNSZSWTWZEOWPTVXDETBI(); +} +extern "C" IntPtr RCKRGDWFTJELCNCJGBFQYXQMFJBOGJCDVTAKHHMSWQFVJLMFTNXDOLJUMXLWCHZK(); +inline static IntPtr System_Drawing_Pens_DarkMagenta() +{ + return RCKRGDWFTJELCNCJGBFQYXQMFJBOGJCDVTAKHHMSWQFVJLMFTNXDOLJUMXLWCHZK(); +} +extern "C" IntPtr GBPIMRBYPMTIRUCUWVVSLZOKKGYKWPQORVOIVESCMZNCRACRURZGMGYHMEYGTRCA(); +inline static IntPtr System_Drawing_Pens_DarkOliveGreen() +{ + return GBPIMRBYPMTIRUCUWVVSLZOKKGYKWPQORVOIVESCMZNCRACRURZGMGYHMEYGTRCA(); +} +extern "C" IntPtr VEQWGUYSCSGLMMSJEGPEPJBLXHVRGMIVXMGMKGLZSGETAMUAMOBMCXKMDFYYZHMP(); +inline static IntPtr System_Drawing_Pens_DarkOrange() +{ + return VEQWGUYSCSGLMMSJEGPEPJBLXHVRGMIVXMGMKGLZSGETAMUAMOBMCXKMDFYYZHMP(); +} +extern "C" IntPtr KKOZFFZYVPMJFHKKMUFRLWTZCUJEHMALUOJPYVUGODQMLBGVUOLFCVENROXLWUQI(); +inline static IntPtr System_Drawing_Pens_DarkOrchid() +{ + return KKOZFFZYVPMJFHKKMUFRLWTZCUJEHMALUOJPYVUGODQMLBGVUOLFCVENROXLWUQI(); +} +extern "C" IntPtr PBORXVMRZYCHGGOBNOJSAVIYJWXJXJKUMHXKMPXZCUFDSXHLZWXHLXHUSPIBXCTQ(); +inline static IntPtr System_Drawing_Pens_DarkRed() +{ + return PBORXVMRZYCHGGOBNOJSAVIYJWXJXJKUMHXKMPXZCUFDSXHLZWXHLXHUSPIBXCTQ(); +} +extern "C" IntPtr OIUYIEOYQJQGPFGLPLJBLCIPZDRWHWCZAOOKDICVHZRBHBENJWLLSRFMZFYFMSRU(); +inline static IntPtr System_Drawing_Pens_DarkSalmon() +{ + return OIUYIEOYQJQGPFGLPLJBLCIPZDRWHWCZAOOKDICVHZRBHBENJWLLSRFMZFYFMSRU(); +} +extern "C" IntPtr HQGBQWIGJNUMLHHYZEMKKQGIJCKXKXJPHWTQVDWNNECEXSASXZFHFGJQJXRNLKVL(); +inline static IntPtr System_Drawing_Pens_DarkSeaGreen() +{ + return HQGBQWIGJNUMLHHYZEMKKQGIJCKXKXJPHWTQVDWNNECEXSASXZFHFGJQJXRNLKVL(); +} +extern "C" IntPtr EEEONQDVHZWFOCLQBSZLRBKANDHXLJCCJRATOMEGVJZGJDCHMAMTLKTCUDAKJFKY(); +inline static IntPtr System_Drawing_Pens_DarkSlateBlue() +{ + return EEEONQDVHZWFOCLQBSZLRBKANDHXLJCCJRATOMEGVJZGJDCHMAMTLKTCUDAKJFKY(); +} +extern "C" IntPtr XUWWBRCPNTPICEQKAZLLWIRYYYYKLUWPZBJPGFFUXWFRULAQMPJKUYBOCYYDTSDS(); +inline static IntPtr System_Drawing_Pens_DarkSlateGray() +{ + return XUWWBRCPNTPICEQKAZLLWIRYYYYKLUWPZBJPGFFUXWFRULAQMPJKUYBOCYYDTSDS(); +} +extern "C" IntPtr WZIBUBEUTRNADZDMXIXVKMVBZVNIHCBFTNVVDYVLLPQDLBLCULFLVHIJEHBZNWNR(); +inline static IntPtr System_Drawing_Pens_DarkTurquoise() +{ + return WZIBUBEUTRNADZDMXIXVKMVBZVNIHCBFTNVVDYVLLPQDLBLCULFLVHIJEHBZNWNR(); +} +extern "C" IntPtr QIHQEIJYMLKVVSPXJLNVWPKLEMQVXVYPBZNDUVYLBHYJXMNMREPCISVAXVLRRNBR(); +inline static IntPtr System_Drawing_Pens_DarkViolet() +{ + return QIHQEIJYMLKVVSPXJLNVWPKLEMQVXVYPBZNDUVYLBHYJXMNMREPCISVAXVLRRNBR(); +} +extern "C" IntPtr NUUWFLDOMBTPRANSYEESFVGIEMFYJGUNFHWCRRGFABPGYGIXISTMJJLROLSSGEEG(); +inline static IntPtr System_Drawing_Pens_DeepPink() +{ + return NUUWFLDOMBTPRANSYEESFVGIEMFYJGUNFHWCRRGFABPGYGIXISTMJJLROLSSGEEG(); +} +extern "C" IntPtr HFJKEKAGXYREGZKYEIQRMHEWVEOGZOZVWJZTWYSXRMOKRGLOBUNXONTZBNOAWUHJ(); +inline static IntPtr System_Drawing_Pens_DeepSkyBlue() +{ + return HFJKEKAGXYREGZKYEIQRMHEWVEOGZOZVWJZTWYSXRMOKRGLOBUNXONTZBNOAWUHJ(); +} +extern "C" IntPtr ZWIXAQBGPSZZTTFPSAFEABGIPARIJSAXFFLVYONKSHIWNUFIIZHVOCIXPAHZZTWW(); +inline static IntPtr System_Drawing_Pens_DimGray() +{ + return ZWIXAQBGPSZZTTFPSAFEABGIPARIJSAXFFLVYONKSHIWNUFIIZHVOCIXPAHZZTWW(); +} +extern "C" IntPtr RBUNHKREMUMTSKUVUJZKLFICXOFXGNKYLLEMZRAYIDJUQOEEFMFQTMLMSSQTETXY(); +inline static IntPtr System_Drawing_Pens_DodgerBlue() +{ + return RBUNHKREMUMTSKUVUJZKLFICXOFXGNKYLLEMZRAYIDJUQOEEFMFQTMLMSSQTETXY(); +} +extern "C" IntPtr JNIHGIVCIBBIVOLIJBSUIUEYARTHBHUPFKKCGXXWQCHSKCQEGIJCADQOJJGOPOBB(); +inline static IntPtr System_Drawing_Pens_Firebrick() +{ + return JNIHGIVCIBBIVOLIJBSUIUEYARTHBHUPFKKCGXXWQCHSKCQEGIJCADQOJJGOPOBB(); +} +extern "C" IntPtr GMCLEIBLDVDFNMOYAPASXROCTVTXRJHBBGLXZFZXGXYFZLBWUHNAOIDOXARIPEUU(); +inline static IntPtr System_Drawing_Pens_FloralWhite() +{ + return GMCLEIBLDVDFNMOYAPASXROCTVTXRJHBBGLXZFZXGXYFZLBWUHNAOIDOXARIPEUU(); +} +extern "C" IntPtr NBDHAQYVPCLZTJCIUWCJVHNTCWAZORICDERYHUWDJSLMWDVNYIOSBKZGOKEDQYHY(); +inline static IntPtr System_Drawing_Pens_ForestGreen() +{ + return NBDHAQYVPCLZTJCIUWCJVHNTCWAZORICDERYHUWDJSLMWDVNYIOSBKZGOKEDQYHY(); +} +extern "C" IntPtr TJWPSEBAAZZCWBWZBMBFCQBSEKJWPTNKLNSNHGVUGOSCLWJNOFCDXBVCHDKHUEKG(); +inline static IntPtr System_Drawing_Pens_Fuchsia() +{ + return TJWPSEBAAZZCWBWZBMBFCQBSEKJWPTNKLNSNHGVUGOSCLWJNOFCDXBVCHDKHUEKG(); +} +extern "C" IntPtr LORJIIRURGYOYZHIAWIKRKMKRPFDWNABDLQWEAEFNHLRCHEIWBGXWAOACHRTDOYE(); +inline static IntPtr System_Drawing_Pens_Gainsboro() +{ + return LORJIIRURGYOYZHIAWIKRKMKRPFDWNABDLQWEAEFNHLRCHEIWBGXWAOACHRTDOYE(); +} +extern "C" IntPtr GWKMILDASCWKYVHKKXGUGDFCWQUXILCYIHKFWSZLXGETEECGZHIFIEXDRHPSRGRG(); +inline static IntPtr System_Drawing_Pens_GhostWhite() +{ + return GWKMILDASCWKYVHKKXGUGDFCWQUXILCYIHKFWSZLXGETEECGZHIFIEXDRHPSRGRG(); +} +extern "C" IntPtr AXBQLBOSXVWAYLYSNNXBDWQEKHNOCHTQPXTGDLUXTPHMHXFGIXEDJPDDHWGEOZQQ(); +inline static IntPtr System_Drawing_Pens_Gold() +{ + return AXBQLBOSXVWAYLYSNNXBDWQEKHNOCHTQPXTGDLUXTPHMHXFGIXEDJPDDHWGEOZQQ(); +} +extern "C" IntPtr BFLARSOCSZIOPEXNBHGECQHZUPYGFQJTYQKBLEOPICKKHPODZSCGTLOLYLFBUIWC(); +inline static IntPtr System_Drawing_Pens_Goldenrod() +{ + return BFLARSOCSZIOPEXNBHGECQHZUPYGFQJTYQKBLEOPICKKHPODZSCGTLOLYLFBUIWC(); +} +extern "C" IntPtr POPYTWBWSQWAFXSFBVHMODAMCYDAYNVAFIUSZQJDRFODPNGBTAAYAJNMODVVTBXF(); +inline static IntPtr System_Drawing_Pens_Gray() +{ + return POPYTWBWSQWAFXSFBVHMODAMCYDAYNVAFIUSZQJDRFODPNGBTAAYAJNMODVVTBXF(); +} +extern "C" IntPtr UWUWCZGLMEVIOXXOSBGYMXZVUIEWUOJPHIITTJZTUPMWOFXQFGCRUZSWXYCTVKQX(); +inline static IntPtr System_Drawing_Pens_Green() +{ + return UWUWCZGLMEVIOXXOSBGYMXZVUIEWUOJPHIITTJZTUPMWOFXQFGCRUZSWXYCTVKQX(); +} +extern "C" IntPtr UFBGOEVICNEXLCHPLNQNLSVHQMVUHFYJYOBIDRCBLUOGVVLURMHHTDMBKTPCIABW(); +inline static IntPtr System_Drawing_Pens_GreenYellow() +{ + return UFBGOEVICNEXLCHPLNQNLSVHQMVUHFYJYOBIDRCBLUOGVVLURMHHTDMBKTPCIABW(); +} +extern "C" IntPtr PUYWAYLULOBRDOMUBBDUYQPVCAYKBASKSSRAXOTSBNVEBUYVGVAGXHYYECUAABSL(); +inline static IntPtr System_Drawing_Pens_Honeydew() +{ + return PUYWAYLULOBRDOMUBBDUYQPVCAYKBASKSSRAXOTSBNVEBUYVGVAGXHYYECUAABSL(); +} +extern "C" IntPtr WRYLXMWMHKTKUKUHBDDFZMMKTTWVTSSZUKIJWMYUZOYNONDTHNYWYNMJENREPBTO(); +inline static IntPtr System_Drawing_Pens_HotPink() +{ + return WRYLXMWMHKTKUKUHBDDFZMMKTTWVTSSZUKIJWMYUZOYNONDTHNYWYNMJENREPBTO(); +} +extern "C" IntPtr STQKCKLPFJGKNZWGPCNFUVBHYZEIVUEXUJVUXTRWCJRPHBWFRLONNNUWSJMCFDTK(); +inline static IntPtr System_Drawing_Pens_IndianRed() +{ + return STQKCKLPFJGKNZWGPCNFUVBHYZEIVUEXUJVUXTRWCJRPHBWFRLONNNUWSJMCFDTK(); +} +extern "C" IntPtr EIQDDBIVLRDKDMZWCZQKFRKHPYCOHOQZPGKYLTBPCTCWKKTGJPAGMJFNXIOFZUNW(); +inline static IntPtr System_Drawing_Pens_Indigo() +{ + return EIQDDBIVLRDKDMZWCZQKFRKHPYCOHOQZPGKYLTBPCTCWKKTGJPAGMJFNXIOFZUNW(); +} +extern "C" IntPtr AEUWBALJXAHLONXEEVFROKMGBXBCEWQHFFWGPWEIEQJLCTYJLJADPWIQROVEZJEB(); +inline static IntPtr System_Drawing_Pens_Ivory() +{ + return AEUWBALJXAHLONXEEVFROKMGBXBCEWQHFFWGPWEIEQJLCTYJLJADPWIQROVEZJEB(); +} +extern "C" IntPtr KZGIRQPHRWNXBBDHYRQVVMSJXGOABAIVLHACNPSVUSMSIKPPKNGISJFYHXLLBOGR(); +inline static IntPtr System_Drawing_Pens_Khaki() +{ + return KZGIRQPHRWNXBBDHYRQVVMSJXGOABAIVLHACNPSVUSMSIKPPKNGISJFYHXLLBOGR(); +} +extern "C" IntPtr OSMTABUIYVACAZANQZQOTACBBCVQEGTGMVEQYVPJTXJXJDYHWXUCYSXNPKRYGEES(); +inline static IntPtr System_Drawing_Pens_Lavender() +{ + return OSMTABUIYVACAZANQZQOTACBBCVQEGTGMVEQYVPJTXJXJDYHWXUCYSXNPKRYGEES(); +} +extern "C" IntPtr CUQEVKPUKGUWQFSYDOTHLQHUXQANEQDPTRVOMTLLIZSRXAXKSSURKWGLMVHEKBQT(); +inline static IntPtr System_Drawing_Pens_LavenderBlush() +{ + return CUQEVKPUKGUWQFSYDOTHLQHUXQANEQDPTRVOMTLLIZSRXAXKSSURKWGLMVHEKBQT(); +} +extern "C" IntPtr DFDYKDLKCIZMXQWWTQVLVLFWLJCRMGBGJZORXYAOGKPBXUOWYKLTFEXRAGNABUYV(); +inline static IntPtr System_Drawing_Pens_LawnGreen() +{ + return DFDYKDLKCIZMXQWWTQVLVLFWLJCRMGBGJZORXYAOGKPBXUOWYKLTFEXRAGNABUYV(); +} +extern "C" IntPtr GSCYBFYUQGFLWDYRVFSBVHAFBWRRLZNMMTVFRPUTLRDYZMVWIWFVCWAZRXWFNHJQ(); +inline static IntPtr System_Drawing_Pens_LemonChiffon() +{ + return GSCYBFYUQGFLWDYRVFSBVHAFBWRRLZNMMTVFRPUTLRDYZMVWIWFVCWAZRXWFNHJQ(); +} +extern "C" IntPtr TSZCISZFKYQDDBFPAUIOTRJQSWNUTPGDINFGMSOPWAKDFWVQRGESYUWCJJJMFFLV(); +inline static IntPtr System_Drawing_Pens_LightBlue() +{ + return TSZCISZFKYQDDBFPAUIOTRJQSWNUTPGDINFGMSOPWAKDFWVQRGESYUWCJJJMFFLV(); +} +extern "C" IntPtr SMVQWZDHGTSTGGKVAXCMKNFOQCXDJCJROPLSBETSDXMFBDVCYNLIDZLEHHATBZYE(); +inline static IntPtr System_Drawing_Pens_LightCoral() +{ + return SMVQWZDHGTSTGGKVAXCMKNFOQCXDJCJROPLSBETSDXMFBDVCYNLIDZLEHHATBZYE(); +} +extern "C" IntPtr JBERURUWDJINBAMMHUEVQBNPDHLUDAQEYIVAYEIHTOETQYCHUNMHVDNHNPNMGASC(); +inline static IntPtr System_Drawing_Pens_LightCyan() +{ + return JBERURUWDJINBAMMHUEVQBNPDHLUDAQEYIVAYEIHTOETQYCHUNMHVDNHNPNMGASC(); +} +extern "C" IntPtr TEOTELOCLWCBXUYFEDZPOIIVUNMIQVBTWBZLJJCIZJVYBLKTQIICACOKWTYRYFMQ(); +inline static IntPtr System_Drawing_Pens_LightGoldenrodYellow() +{ + return TEOTELOCLWCBXUYFEDZPOIIVUNMIQVBTWBZLJJCIZJVYBLKTQIICACOKWTYRYFMQ(); +} +extern "C" IntPtr VIFVUMVVAQQENJTJCTRHNZSTNPPPKLJUXFDSFPYDNMBJMKXMZPOFNECWPMHFXFLP(); +inline static IntPtr System_Drawing_Pens_LightGreen() +{ + return VIFVUMVVAQQENJTJCTRHNZSTNPPPKLJUXFDSFPYDNMBJMKXMZPOFNECWPMHFXFLP(); +} +extern "C" IntPtr GVHHGBDMVNTBXJGDSCPUWEHSDHCTHTGHALDRCPGYMCJZKBYGGENUPRSBOOEZYKEC(); +inline static IntPtr System_Drawing_Pens_LightGray() +{ + return GVHHGBDMVNTBXJGDSCPUWEHSDHCTHTGHALDRCPGYMCJZKBYGGENUPRSBOOEZYKEC(); +} +extern "C" IntPtr HMAMFPACWRHUVHHBIWNCGMRJTBCOLHACXHSYBMAQEKXYJYGGHCQCWBVVUQSEMMQP(); +inline static IntPtr System_Drawing_Pens_LightPink() +{ + return HMAMFPACWRHUVHHBIWNCGMRJTBCOLHACXHSYBMAQEKXYJYGGHCQCWBVVUQSEMMQP(); +} +extern "C" IntPtr RFXNPJAWVWYVOTAUUWGIQXFVLWEKTWDSUHHDBTQYCTGADAGAQYJQFHYTABBSEPDZ(); +inline static IntPtr System_Drawing_Pens_LightSalmon() +{ + return RFXNPJAWVWYVOTAUUWGIQXFVLWEKTWDSUHHDBTQYCTGADAGAQYJQFHYTABBSEPDZ(); +} +extern "C" IntPtr SFAGMWTBFIGXRERLPDUVMNNMJNDZRYTNQGHYZAOUEHLWBBBVJQDAVIMFSOXYSUKH(); +inline static IntPtr System_Drawing_Pens_LightSeaGreen() +{ + return SFAGMWTBFIGXRERLPDUVMNNMJNDZRYTNQGHYZAOUEHLWBBBVJQDAVIMFSOXYSUKH(); +} +extern "C" IntPtr PTHKXTLPPZQEBRKHLIPBUSRHUCGLDPBKXEGIURXQENLVRHDADPMJEJMWBZQUNAMZ(); +inline static IntPtr System_Drawing_Pens_LightSkyBlue() +{ + return PTHKXTLPPZQEBRKHLIPBUSRHUCGLDPBKXEGIURXQENLVRHDADPMJEJMWBZQUNAMZ(); +} +extern "C" IntPtr XGHXKBNUKZWHGVQMZFHNCSFNSJHUADDEBLXLAFQCBRYFNEQFJEVITYWFATFAUSTH(); +inline static IntPtr System_Drawing_Pens_LightSlateGray() +{ + return XGHXKBNUKZWHGVQMZFHNCSFNSJHUADDEBLXLAFQCBRYFNEQFJEVITYWFATFAUSTH(); +} +extern "C" IntPtr VSFVYELTOEMLTAANTCLWIVLDORLGAQIJYRJUZUHESBTOMLMZTRGSHXZAHCGGTFTY(); +inline static IntPtr System_Drawing_Pens_LightSteelBlue() +{ + return VSFVYELTOEMLTAANTCLWIVLDORLGAQIJYRJUZUHESBTOMLMZTRGSHXZAHCGGTFTY(); +} +extern "C" IntPtr WDMBRFOYUGEGBWRDFLNIJPBBSINXOALNIURJZLINDHXASSZKKDBHSKOHBLJISQKU(); +inline static IntPtr System_Drawing_Pens_LightYellow() +{ + return WDMBRFOYUGEGBWRDFLNIJPBBSINXOALNIURJZLINDHXASSZKKDBHSKOHBLJISQKU(); +} +extern "C" IntPtr VRYGFIEUCAEBSBIZJDMLZDVXFKHNBAVNXDEBUSECYGERFMOZDJZOEYUSWAAVAQSC(); +inline static IntPtr System_Drawing_Pens_Lime() +{ + return VRYGFIEUCAEBSBIZJDMLZDVXFKHNBAVNXDEBUSECYGERFMOZDJZOEYUSWAAVAQSC(); +} +extern "C" IntPtr FREPXGFRZJMSYDRTVIKSBGIYIMFTRJCIOCMOIZCXDHPULBTSJHZRGZBYJFGKAMAP(); +inline static IntPtr System_Drawing_Pens_LimeGreen() +{ + return FREPXGFRZJMSYDRTVIKSBGIYIMFTRJCIOCMOIZCXDHPULBTSJHZRGZBYJFGKAMAP(); +} +extern "C" IntPtr HEEWQDKWFMPTRNMGTNJJJKBOAOFCSRWQHZNHWXCFWCLTKIHVTZRNCQGWCQVCYIEO(); +inline static IntPtr System_Drawing_Pens_Linen() +{ + return HEEWQDKWFMPTRNMGTNJJJKBOAOFCSRWQHZNHWXCFWCLTKIHVTZRNCQGWCQVCYIEO(); +} +extern "C" IntPtr QYMRAFKVKEMGZHESHKJSAJNQTREGBAHOYXDLWPUNPVCYEZXUMDUOZMNGKVYJADUK(); +inline static IntPtr System_Drawing_Pens_Magenta() +{ + return QYMRAFKVKEMGZHESHKJSAJNQTREGBAHOYXDLWPUNPVCYEZXUMDUOZMNGKVYJADUK(); +} +extern "C" IntPtr WXIBESWSPVCEGPLTUKUXFTPLJWAAQLNMASBGRVQTHCYDKJAVKEPPJWFDIWRHRVBD(); +inline static IntPtr System_Drawing_Pens_Maroon() +{ + return WXIBESWSPVCEGPLTUKUXFTPLJWAAQLNMASBGRVQTHCYDKJAVKEPPJWFDIWRHRVBD(); +} +extern "C" IntPtr HPDONECYUAQCULBAWFQMWXDENYYUDICLBUWUFMIFCQVIGCJWVRLMFPHJMZAPFHUL(); +inline static IntPtr System_Drawing_Pens_MediumAquamarine() +{ + return HPDONECYUAQCULBAWFQMWXDENYYUDICLBUWUFMIFCQVIGCJWVRLMFPHJMZAPFHUL(); +} +extern "C" IntPtr YFAZPGVJXKJFCVYKPCZMWPFMNMIGLSZUVKJABJGOWCPUFBHRBQADHHPIZOMDYPXE(); +inline static IntPtr System_Drawing_Pens_MediumBlue() +{ + return YFAZPGVJXKJFCVYKPCZMWPFMNMIGLSZUVKJABJGOWCPUFBHRBQADHHPIZOMDYPXE(); +} +extern "C" IntPtr LPKRLXIFWLQUALHLEREVSVMNVABNWCPGEKIPRPGDHUHWRUIOGBYHKCLPCWWKWUJT(); +inline static IntPtr System_Drawing_Pens_MediumOrchid() +{ + return LPKRLXIFWLQUALHLEREVSVMNVABNWCPGEKIPRPGDHUHWRUIOGBYHKCLPCWWKWUJT(); +} +extern "C" IntPtr VJPPCRTPKBOYOQWASMGVEIWCZTNVSVHMKOBHFTLPHIWIONBMZWSJNNOMNNQJDYWO(); +inline static IntPtr System_Drawing_Pens_MediumPurple() +{ + return VJPPCRTPKBOYOQWASMGVEIWCZTNVSVHMKOBHFTLPHIWIONBMZWSJNNOMNNQJDYWO(); +} +extern "C" IntPtr UBNAOOUYBROVMNOLSAVVDXYXZOURDCLIMHOMZBXKCTIWZTAZZERDCBLWCQAAUCVY(); +inline static IntPtr System_Drawing_Pens_MediumSeaGreen() +{ + return UBNAOOUYBROVMNOLSAVVDXYXZOURDCLIMHOMZBXKCTIWZTAZZERDCBLWCQAAUCVY(); +} +extern "C" IntPtr FGJEZBLRDLTKOCYFNVSYLIGKWRJJAXQZYKRTKWAXTAZRHAIASUMZKWMXZYIHRBQG(); +inline static IntPtr System_Drawing_Pens_MediumSlateBlue() +{ + return FGJEZBLRDLTKOCYFNVSYLIGKWRJJAXQZYKRTKWAXTAZRHAIASUMZKWMXZYIHRBQG(); +} +extern "C" IntPtr UUMELFVRVVFLIODVJJRFKROBXTTLNSFRJTWNODPNYUDORBOLVMYIKLVDFKHRLKDC(); +inline static IntPtr System_Drawing_Pens_MediumSpringGreen() +{ + return UUMELFVRVVFLIODVJJRFKROBXTTLNSFRJTWNODPNYUDORBOLVMYIKLVDFKHRLKDC(); +} +extern "C" IntPtr POCOSPHFTEGPNZKWFHPBUWGXYSHDWYBOQAZCYZSFFSPFFGPFAKLEUCITHEQZHDJU(); +inline static IntPtr System_Drawing_Pens_MediumTurquoise() +{ + return POCOSPHFTEGPNZKWFHPBUWGXYSHDWYBOQAZCYZSFFSPFFGPFAKLEUCITHEQZHDJU(); +} +extern "C" IntPtr DRYMAHXFOJVBHASRCCDMMXTORGUUJTYCIUCNHDESMGPKHHLGLYWFZXHFXKUUMDWV(); +inline static IntPtr System_Drawing_Pens_MediumVioletRed() +{ + return DRYMAHXFOJVBHASRCCDMMXTORGUUJTYCIUCNHDESMGPKHHLGLYWFZXHFXKUUMDWV(); +} +extern "C" IntPtr LTSMYFJZXKZGIJHKUOIKWSCLMWPXIKFJKTYNOZIGPWHOYBXODKZYULYTQHZBQMRN(); +inline static IntPtr System_Drawing_Pens_MidnightBlue() +{ + return LTSMYFJZXKZGIJHKUOIKWSCLMWPXIKFJKTYNOZIGPWHOYBXODKZYULYTQHZBQMRN(); +} +extern "C" IntPtr FPWOKTWVFCVZKNNLZAUYKGOYUFWGZHPCFUJIFJEJNETSQZIDUOCPRTCYBXUEWPVY(); +inline static IntPtr System_Drawing_Pens_MintCream() +{ + return FPWOKTWVFCVZKNNLZAUYKGOYUFWGZHPCFUJIFJEJNETSQZIDUOCPRTCYBXUEWPVY(); +} +extern "C" IntPtr MSUQDFGPVKKFNWIVXTMLFZKLRLGHPANYJUFXERZOIMUHJXKFPYHDCKSMHIYSYYAV(); +inline static IntPtr System_Drawing_Pens_MistyRose() +{ + return MSUQDFGPVKKFNWIVXTMLFZKLRLGHPANYJUFXERZOIMUHJXKFPYHDCKSMHIYSYYAV(); +} +extern "C" IntPtr XMWSQKRFTYCSFDCUABSQSJVZCSPVTHQJLYKWBROEHBKEHZHEGERWGJDNQXQXVVMM(); +inline static IntPtr System_Drawing_Pens_Moccasin() +{ + return XMWSQKRFTYCSFDCUABSQSJVZCSPVTHQJLYKWBROEHBKEHZHEGERWGJDNQXQXVVMM(); +} +extern "C" IntPtr HTHHTFSJMNJRZQRCLLPOPTCBVWGEARJMPXXOSZKALIKTALNAFOMJFXWOQFMWZOIV(); +inline static IntPtr System_Drawing_Pens_NavajoWhite() +{ + return HTHHTFSJMNJRZQRCLLPOPTCBVWGEARJMPXXOSZKALIKTALNAFOMJFXWOQFMWZOIV(); +} +extern "C" IntPtr EXBBTCJLAOCHJJBJIFYMEZGRBJYNNOBXZPODKLGCEAJRVOFGDDNTQWQERJAKEWYM(); +inline static IntPtr System_Drawing_Pens_Navy() +{ + return EXBBTCJLAOCHJJBJIFYMEZGRBJYNNOBXZPODKLGCEAJRVOFGDDNTQWQERJAKEWYM(); +} +extern "C" IntPtr NFITVYZWZVHEQPWMDRJKAHHDYJLALVYHBWDQGLKFDQTUOMOCNOGMNOMFXFVLMZLD(); +inline static IntPtr System_Drawing_Pens_OldLace() +{ + return NFITVYZWZVHEQPWMDRJKAHHDYJLALVYHBWDQGLKFDQTUOMOCNOGMNOMFXFVLMZLD(); +} +extern "C" IntPtr XZCTLGFSHDGJONOLVJMWPLUNKYSBPZTEFQWOKUQGINFJICRKQKQCMOOMFOIMODDH(); +inline static IntPtr System_Drawing_Pens_Olive() +{ + return XZCTLGFSHDGJONOLVJMWPLUNKYSBPZTEFQWOKUQGINFJICRKQKQCMOOMFOIMODDH(); +} +extern "C" IntPtr KBEXQABATFOBFLEIHHLFIQSQBKJVMESEKXYGYTUQJQJGANGTJAFGSYZUJNWFQFOO(); +inline static IntPtr System_Drawing_Pens_OliveDrab() +{ + return KBEXQABATFOBFLEIHHLFIQSQBKJVMESEKXYGYTUQJQJGANGTJAFGSYZUJNWFQFOO(); +} +extern "C" IntPtr NJQIMYJONVWSHLPOEPMLZLMMYEXKWOZDCUTRWYGLQQTXCGMYYHBATCPBXEJIBZRY(); +inline static IntPtr System_Drawing_Pens_Orange() +{ + return NJQIMYJONVWSHLPOEPMLZLMMYEXKWOZDCUTRWYGLQQTXCGMYYHBATCPBXEJIBZRY(); +} +extern "C" IntPtr VSQMSXSFIAUIROJSRZMPNYKZFRUROYKRZVCKPAFAPVSSHHKIURQCMCLWHQHBDARK(); +inline static IntPtr System_Drawing_Pens_OrangeRed() +{ + return VSQMSXSFIAUIROJSRZMPNYKZFRUROYKRZVCKPAFAPVSSHHKIURQCMCLWHQHBDARK(); +} +extern "C" IntPtr PCIWMZCRTMZRGSRXGMWXHIFXKFCYTEWPEHCEYOWUOZIACTPPZJURETCHXLLGXDXO(); +inline static IntPtr System_Drawing_Pens_Orchid() +{ + return PCIWMZCRTMZRGSRXGMWXHIFXKFCYTEWPEHCEYOWUOZIACTPPZJURETCHXLLGXDXO(); +} +extern "C" IntPtr PKNYPNZSQBJIZEUQPNZKKFLLFVGNCPXKCULSGRAMJBBCKTHTQVQJDNDJZCSTGLQA(); +inline static IntPtr System_Drawing_Pens_PaleGoldenrod() +{ + return PKNYPNZSQBJIZEUQPNZKKFLLFVGNCPXKCULSGRAMJBBCKTHTQVQJDNDJZCSTGLQA(); +} +extern "C" IntPtr DYGESCJYNNAJEIBLNNXGYNHORBTEYGFYKAYLNDAOLSWQNUFQBHGSOJCPRRNRIFAG(); +inline static IntPtr System_Drawing_Pens_PaleGreen() +{ + return DYGESCJYNNAJEIBLNNXGYNHORBTEYGFYKAYLNDAOLSWQNUFQBHGSOJCPRRNRIFAG(); +} +extern "C" IntPtr HBYDKPYKNJVGRQBXWCDRZNKAYIUWPJFGRPILVBGLIWFEOVYAQQUGCJHURXFBUCUD(); +inline static IntPtr System_Drawing_Pens_PaleTurquoise() +{ + return HBYDKPYKNJVGRQBXWCDRZNKAYIUWPJFGRPILVBGLIWFEOVYAQQUGCJHURXFBUCUD(); +} +extern "C" IntPtr EPOBIPBVWRIDHFMCJUFYOYDIIOUYWERGBBAZGXRAPZJKBDMLLCRZWWPFLGSUVDYR(); +inline static IntPtr System_Drawing_Pens_PaleVioletRed() +{ + return EPOBIPBVWRIDHFMCJUFYOYDIIOUYWERGBBAZGXRAPZJKBDMLLCRZWWPFLGSUVDYR(); +} +extern "C" IntPtr ZBCGFMVMDFJPOTHEBIMTNRKFMUOAEXELASKZBFFYHFWRMZQRZOSNQFEHRXTLYVHF(); +inline static IntPtr System_Drawing_Pens_PapayaWhip() +{ + return ZBCGFMVMDFJPOTHEBIMTNRKFMUOAEXELASKZBFFYHFWRMZQRZOSNQFEHRXTLYVHF(); +} +extern "C" IntPtr AXOWIHDVCNMHVSSMDWBQERVVOCIEMUALXQROLUISLWKDTWMYEGHBURAICTIGYYJH(); +inline static IntPtr System_Drawing_Pens_PeachPuff() +{ + return AXOWIHDVCNMHVSSMDWBQERVVOCIEMUALXQROLUISLWKDTWMYEGHBURAICTIGYYJH(); +} +extern "C" IntPtr NAKEBDBJNJFIGSBSQKAFNZRFQIMRMCTMMDPSLIWAFXNKMSCKRQQOYETNIEOTRJXK(); +inline static IntPtr System_Drawing_Pens_Peru() +{ + return NAKEBDBJNJFIGSBSQKAFNZRFQIMRMCTMMDPSLIWAFXNKMSCKRQQOYETNIEOTRJXK(); +} +extern "C" IntPtr PSVDCIGHNZZQLGTXFBZWMFOIJCKHTDJVZCVTXZIIJIAYEDCBKQNPKBYKDNTAYZOK(); +inline static IntPtr System_Drawing_Pens_Pink() +{ + return PSVDCIGHNZZQLGTXFBZWMFOIJCKHTDJVZCVTXZIIJIAYEDCBKQNPKBYKDNTAYZOK(); +} +extern "C" IntPtr QEQILAAGTRMEEQDGZIWCPTLYEKPJGIKKUPIAMUQKQHWTOUFNJMAQCLVXTRDBKQAL(); +inline static IntPtr System_Drawing_Pens_Plum() +{ + return QEQILAAGTRMEEQDGZIWCPTLYEKPJGIKKUPIAMUQKQHWTOUFNJMAQCLVXTRDBKQAL(); +} +extern "C" IntPtr GCKPICTFSLMIWSJKECATHTHIULHUQPAAHLMMJQFHSVXQZNAAITWHQGDMUBUXVZOD(); +inline static IntPtr System_Drawing_Pens_PowderBlue() +{ + return GCKPICTFSLMIWSJKECATHTHIULHUQPAAHLMMJQFHSVXQZNAAITWHQGDMUBUXVZOD(); +} +extern "C" IntPtr LLBLGWANWSAMVQJHKGMXSSKAIZSIWILTGUFNMOULSILXFQQDRNMOMRKTBADHERRO(); +inline static IntPtr System_Drawing_Pens_Purple() +{ + return LLBLGWANWSAMVQJHKGMXSSKAIZSIWILTGUFNMOULSILXFQQDRNMOMRKTBADHERRO(); +} +extern "C" IntPtr HGFBLWVVMBEJHMURIORIWXHPKMLLLNHARWQZLPSUSQCLMAMPGLYPAJRJZPQZLJJY(); +inline static IntPtr System_Drawing_Pens_Red() +{ + return HGFBLWVVMBEJHMURIORIWXHPKMLLLNHARWQZLPSUSQCLMAMPGLYPAJRJZPQZLJJY(); +} +extern "C" IntPtr TDSKWVFSWWPFUVDKAWEAORAIEGZVZTJIGERIHBSLFGSDTMPDMGYOFJJBCKFPVKSD(); +inline static IntPtr System_Drawing_Pens_RosyBrown() +{ + return TDSKWVFSWWPFUVDKAWEAORAIEGZVZTJIGERIHBSLFGSDTMPDMGYOFJJBCKFPVKSD(); +} +extern "C" IntPtr NGZQEUCYDTUIZXOSQVITUUDWUPFXWCPVNPQMMZZSDALLPBCFVMZZBZJSDDWOOEBA(); +inline static IntPtr System_Drawing_Pens_RoyalBlue() +{ + return NGZQEUCYDTUIZXOSQVITUUDWUPFXWCPVNPQMMZZSDALLPBCFVMZZBZJSDDWOOEBA(); +} +extern "C" IntPtr EYUKHCGRWQPTJSGSNABKDPUOFYJJCLDZYKHRHSYTFHDKKPILWDBODRWOEGEJSWOL(); +inline static IntPtr System_Drawing_Pens_SaddleBrown() +{ + return EYUKHCGRWQPTJSGSNABKDPUOFYJJCLDZYKHRHSYTFHDKKPILWDBODRWOEGEJSWOL(); +} +extern "C" IntPtr NQUYKPLUCHEWLJEQPYNZJOVHOSMAOPAJSSWTVKAGRHMVMZDUCOTUJPBYUNKSCKFM(); +inline static IntPtr System_Drawing_Pens_Salmon() +{ + return NQUYKPLUCHEWLJEQPYNZJOVHOSMAOPAJSSWTVKAGRHMVMZDUCOTUJPBYUNKSCKFM(); +} +extern "C" IntPtr HVETMKVFXGHCCAUOPRYAVGZCRYZHZIDHBZORVJIRTOWDIYWUSVCLLFRAWBBOLNFP(); +inline static IntPtr System_Drawing_Pens_SandyBrown() +{ + return HVETMKVFXGHCCAUOPRYAVGZCRYZHZIDHBZORVJIRTOWDIYWUSVCLLFRAWBBOLNFP(); +} +extern "C" IntPtr CABCMCTFJHGHJVUSCFPEFSVVINVTITGGIHAIWTHPCWBEYJRAHJMGXBJJEGUYHZXQ(); +inline static IntPtr System_Drawing_Pens_SeaGreen() +{ + return CABCMCTFJHGHJVUSCFPEFSVVINVTITGGIHAIWTHPCWBEYJRAHJMGXBJJEGUYHZXQ(); +} +extern "C" IntPtr AAZBVMVIXZCIRQWZVVMYHAIHXRDQZJICZKEXKQFVNDJYZASNKVDMNYJASSDEIFJN(); +inline static IntPtr System_Drawing_Pens_SeaShell() +{ + return AAZBVMVIXZCIRQWZVVMYHAIHXRDQZJICZKEXKQFVNDJYZASNKVDMNYJASSDEIFJN(); +} +extern "C" IntPtr RZJGMYOFQRLDRJHXZPGDFVPABEFRMBMHUVGZQLALGXWWNFIJKGFSZFIVJJFITXTO(); +inline static IntPtr System_Drawing_Pens_Sienna() +{ + return RZJGMYOFQRLDRJHXZPGDFVPABEFRMBMHUVGZQLALGXWWNFIJKGFSZFIVJJFITXTO(); +} +extern "C" IntPtr EDJWCIGNOUXHZTMWVVHFWTIOMLPHGSSJEHRKWMGCARDFIAWQWINXPNSKUVJRSZHW(); +inline static IntPtr System_Drawing_Pens_Silver() +{ + return EDJWCIGNOUXHZTMWVVHFWTIOMLPHGSSJEHRKWMGCARDFIAWQWINXPNSKUVJRSZHW(); +} +extern "C" IntPtr BODRBCAJPFFEQDFMOZKXFVTQOGPACPJBJHDUWEOUIDIJIOURPWCSOKRGUMDVNZGZ(); +inline static IntPtr System_Drawing_Pens_SkyBlue() +{ + return BODRBCAJPFFEQDFMOZKXFVTQOGPACPJBJHDUWEOUIDIJIOURPWCSOKRGUMDVNZGZ(); +} +extern "C" IntPtr VDVIZLPKLPOBMJHALXLGMRMZPXZKATGJXIOETLSDHSHZVQTKFDJPNANERVTBMFJR(); +inline static IntPtr System_Drawing_Pens_SlateBlue() +{ + return VDVIZLPKLPOBMJHALXLGMRMZPXZKATGJXIOETLSDHSHZVQTKFDJPNANERVTBMFJR(); +} +extern "C" IntPtr IFDEVCGZEHYUJNEZEOEXJQVXVJNXSQRBJPQPMOPCWJKFBTUEQUXXALHRJGJLPJHN(); +inline static IntPtr System_Drawing_Pens_SlateGray() +{ + return IFDEVCGZEHYUJNEZEOEXJQVXVJNXSQRBJPQPMOPCWJKFBTUEQUXXALHRJGJLPJHN(); +} +extern "C" IntPtr QXKTXOMPZCBAGQWBPIGYTUAXHYGGFDMNBWPDIBHCHIYXKHLTKHWHCJUVWNLYIGJV(); +inline static IntPtr System_Drawing_Pens_Snow() +{ + return QXKTXOMPZCBAGQWBPIGYTUAXHYGGFDMNBWPDIBHCHIYXKHLTKHWHCJUVWNLYIGJV(); +} +extern "C" IntPtr QNYJASTOBEQLWCNAMNWYHFLSCTGVPIUAYCHWJCSRNIFXSIZUALMUKKNKCFGHLYYS(); +inline static IntPtr System_Drawing_Pens_SpringGreen() +{ + return QNYJASTOBEQLWCNAMNWYHFLSCTGVPIUAYCHWJCSRNIFXSIZUALMUKKNKCFGHLYYS(); +} +extern "C" IntPtr KQNTVQQJUEKZZNATTMVDVZPNOWUDWLFPJNMCVGYJUDAGZOLOFMNYDVWLAZFYWNMI(); +inline static IntPtr System_Drawing_Pens_SteelBlue() +{ + return KQNTVQQJUEKZZNATTMVDVZPNOWUDWLFPJNMCVGYJUDAGZOLOFMNYDVWLAZFYWNMI(); +} +extern "C" IntPtr YVQMBYYNNLJSYJNALFYKYHLNQBBWBANHQRHEXYNGOZLRLEMQLEMQOCKRKCWZWCMN(); +inline static IntPtr System_Drawing_Pens_Tan() +{ + return YVQMBYYNNLJSYJNALFYKYHLNQBBWBANHQRHEXYNGOZLRLEMQLEMQOCKRKCWZWCMN(); +} +extern "C" IntPtr XBBHBJCNSRWYWTBLPLKWOXTOGQUVCOKMNYTKDEOCCZYWGLVQAKJLRQYAIMALPHKE(); +inline static IntPtr System_Drawing_Pens_Teal() +{ + return XBBHBJCNSRWYWTBLPLKWOXTOGQUVCOKMNYTKDEOCCZYWGLVQAKJLRQYAIMALPHKE(); +} +extern "C" IntPtr HKLXZRIKWIUOZWIVVDUREYUWZTBQEDMVOTPWZXQICZPJVKBMEFPLMTZIPOYGQRGS(); +inline static IntPtr System_Drawing_Pens_Thistle() +{ + return HKLXZRIKWIUOZWIVVDUREYUWZTBQEDMVOTPWZXQICZPJVKBMEFPLMTZIPOYGQRGS(); +} +extern "C" IntPtr VZZFGLVYNLPFJKBORPLZOAIVUHGKYJSKTXNWKWGSJRYADUYFNKPBFHEUQEKYFKZE(); +inline static IntPtr System_Drawing_Pens_Tomato() +{ + return VZZFGLVYNLPFJKBORPLZOAIVUHGKYJSKTXNWKWGSJRYADUYFNKPBFHEUQEKYFKZE(); +} +extern "C" IntPtr TELMWEEUITPWCIRZIBXOTREMSTGGLHNZSTGYILIJGUSMRHSIMLPENLKBAZTDYXJB(); +inline static IntPtr System_Drawing_Pens_Turquoise() +{ + return TELMWEEUITPWCIRZIBXOTREMSTGGLHNZSTGYILIJGUSMRHSIMLPENLKBAZTDYXJB(); +} +extern "C" IntPtr GPEIBTQWTNIZZSUKBXUARJMGJFYISELILQGCDJGTUSKZCKCIFJCACIKXDXYWUHEP(); +inline static IntPtr System_Drawing_Pens_Violet() +{ + return GPEIBTQWTNIZZSUKBXUARJMGJFYISELILQGCDJGTUSKZCKCIFJCACIKXDXYWUHEP(); +} +extern "C" IntPtr CZNILSHRQBFYYMEYCQDJBKFCGJYGKKYMOVXDWUWNBLJBDLYQTZUDEVNSULCCTAHG(); +inline static IntPtr System_Drawing_Pens_Wheat() +{ + return CZNILSHRQBFYYMEYCQDJBKFCGJYGKKYMOVXDWUWNBLJBDLYQTZUDEVNSULCCTAHG(); +} +extern "C" IntPtr CSKCPBCIUPHQAEZUKHNKQVISIEILRTUBDDYKBVBRXLIPOXRQMIRLMWPHKRUKSQQA(); +inline static IntPtr System_Drawing_Pens_White() +{ + return CSKCPBCIUPHQAEZUKHNKQVISIEILRTUBDDYKBVBRXLIPOXRQMIRLMWPHKRUKSQQA(); +} +extern "C" IntPtr VFMXFOSPGVMEMTDLNSZJCIOHNRAJAQZHVITIKTKXPCFRKLUROJWZRHYMRFKNNIOP(); +inline static IntPtr System_Drawing_Pens_WhiteSmoke() +{ + return VFMXFOSPGVMEMTDLNSZJCIOHNRAJAQZHVITIKTKXPCFRKLUROJWZRHYMRFKNNIOP(); +} +extern "C" IntPtr VFJEZVAUHBTZCXWBWJVRUAPOJHRFIXKGNQVEBQRTJCRQNYJUIIQENXUVPVUSDVLK(); +inline static IntPtr System_Drawing_Pens_Yellow() +{ + return VFJEZVAUHBTZCXWBWJVRUAPOJHRFIXKGNQVEBQRTJCRQNYJUIIQENXUVPVUSDVLK(); +} +extern "C" IntPtr RNMMBSAGRCHRIZALXXWAGFTQVZOGWZPNQHZAMXSQIKMKPCNQUIUGYLDLTVRBDTJR(); +inline static IntPtr System_Drawing_Pens_YellowGreen() +{ + return RNMMBSAGRCHRIZALXXWAGFTQVZOGWZPNQHZAMXSQIKMKPCNQUIUGYLDLTVRBDTJR(); +} +extern "C" IntPtr MTBAZAZZEGRWTIBSLXMNEJPFEOGQGRMPAUXVBNRTJVCRTHSLUYPFHWMDEVVLTITN(const char* _name , float size); +inline static IntPtr System_Drawing_Font_New(const char* _name , float size) +{ + return MTBAZAZZEGRWTIBSLXMNEJPFEOGQGRMPAUXVBNRTJVCRTHSLUYPFHWMDEVVLTITN(_name , size); +} +extern "C" IntPtr BHLAOKFLUQAPOMFGZGVPXAEQNVKKBIEFGZREQVPBQFAGSILMJMRLGZRBDUNTZVJM(int argb , float wid); +inline static IntPtr System_Drawing_Pen_New(int argb , float wid) +{ + return BHLAOKFLUQAPOMFGZGVPXAEQNVKKBIEFGZREQVPBQFAGSILMJMRLGZRBDUNTZVJM(argb , wid); +} +extern "C" IntPtr UCVYKFQYGSEJHXLXWVWHBGHEITRFRFZBBOXQLTAOHRYPRCWGKYPYLLMNVRQQOLGB(IntPtr bmp); +inline static IntPtr System_Drawing_Graphics_FromBitmap(IntPtr bmp) +{ + return UCVYKFQYGSEJHXLXWVWHBGHEITRFRFZBBOXQLTAOHRYPRCWGKYPYLLMNVRQQOLGB(bmp); +} +extern "C" IntPtr SCISAULCVHAJHSMFXKVSPBPQCJVUDJAWKXXOUEFPNNCELCFCEKTDPNLQNSPQZRYM(HWND hwnd); +inline static IntPtr System_Drawing_Graphics_FromHwnd(HWND hwnd) +{ + return SCISAULCVHAJHSMFXKVSPBPQCJVUDJAWKXXOUEFPNNCELCFCEKTDPNLQNSPQZRYM(hwnd); +} +extern "C" IntPtr HDYKVXKSEGFCYKEZDSPSPWGWLGBCOOQVPQXHEVHGAAYJIJRCNQNGBFWKWBYOWIEP(HDC hdc); +inline static IntPtr System_Drawing_Graphics_FromHdc(HDC hdc) +{ + return HDYKVXKSEGFCYKEZDSPSPWGWLGBCOOQVPQXHEVHGAAYJIJRCNQNGBFWKWBYOWIEP(hdc); +} +extern "C" void QJNHNXVILISOXXOCOYOYBJUJUMLCXSKSWITYWJPQUFUSNHMZNWAXTGOGPDNALTKS(IntPtr _g , int sl , int st , int dl , int dt , int wid , int hei); +inline static void System_Drawing_Graphics_CopyFromScreen(IntPtr _g , int sl , int st , int dl , int dt , int wid , int hei) +{ + QJNHNXVILISOXXOCOYOYBJUJUMLCXSKSWITYWJPQUFUSNHMZNWAXTGOGPDNALTKS(_g , sl , st , dl , dt , wid , hei); +} +extern "C" void YZSOEQGEJYDWPBVMALPBSMZQUMISWOEBUBUNPXUWPVOUCRROHBAADJALACURHNIU(IntPtr _g , IntPtr _p , float x1 , float y1 , float x2 , float y2); +inline static void System_Drawing_Graphics_DrawLine(IntPtr _g , IntPtr _p , float x1 , float y1 , float x2 , float y2) +{ + YZSOEQGEJYDWPBVMALPBSMZQUMISWOEBUBUNPXUWPVOUCRROHBAADJALACURHNIU(_g , _p , x1 , y1 , x2 , y2); +} +extern "C" void TCCNGIWCRSLWYENDVTKUOEXKBJNNDDPCMTAAPDIZFXILYDMWPRVNDOGPERLXVIZN(IntPtr _g , IntPtr _p , float x1 , float y1 , float x2 , float y2 , float x3 , float y3 , float x4 , float y4); +inline static void System_Drawing_Graphics_DrawBezier(IntPtr _g , IntPtr _p , float x1 , float y1 , float x2 , float y2 , float x3 , float y3 , float x4 , float y4) +{ + TCCNGIWCRSLWYENDVTKUOEXKBJNNDDPCMTAAPDIZFXILYDMWPRVNDOGPERLXVIZN(_g , _p , x1 , y1 , x2 , y2 , x3 , y3 , x4 , y4); +} +extern "C" void CJKEDMNRLKORVLMXWQYMHBYYNLWYSKEWXUIPTISCDDCSZOTSEOAEKNGBKLQSPPZA(IntPtr _g , IntPtr _p , float x , float y , float w , float h); +inline static void System_Drawing_Graphics_DrawEllipse(IntPtr _g , IntPtr _p , float x , float y , float w , float h) +{ + CJKEDMNRLKORVLMXWQYMHBYYNLWYSKEWXUIPTISCDDCSZOTSEOAEKNGBKLQSPPZA(_g , _p , x , y , w , h); +} +extern "C" void DFFBNCJADYIVLJTEGUNIKDGRIWKHLOWAKLVJYUAXHVOTLCWDLWRVWTXAZOTRSBOO(IntPtr _g , IntPtr _p , float x , float y , float w , float h); +inline static void System_Drawing_Graphics_FillEllipse(IntPtr _g , IntPtr _p , float x , float y , float w , float h) +{ + DFFBNCJADYIVLJTEGUNIKDGRIWKHLOWAKLVJYUAXHVOTLCWDLWRVWTXAZOTRSBOO(_g , _p , x , y , w , h); +} +extern "C" void GSUADXEOYVIDZFZZRDTDJZLKOHEHRANNEBMGUSPGJMFPECBEMRALVVRGGKMVTWWY(IntPtr _g , IntPtr _p , float x , float y , float w , float h); +inline static void System_Drawing_Graphics_DrawRectangle(IntPtr _g , IntPtr _p , float x , float y , float w , float h) +{ + GSUADXEOYVIDZFZZRDTDJZLKOHEHRANNEBMGUSPGJMFPECBEMRALVVRGGKMVTWWY(_g , _p , x , y , w , h); +} +extern "C" void NWOJAZXBOYERIRBVMQKTIEIJICINZGUYLGEYMMMMKMTYPDWNAQVRRUXINFAXQJCI(IntPtr _g , IntPtr _p , float x , float y , float w , float h); +inline static void System_Drawing_Graphics_FillRectangle(IntPtr _g , IntPtr _p , float x , float y , float w , float h) +{ + NWOJAZXBOYERIRBVMQKTIEIJICINZGUYLGEYMMMMKMTYPDWNAQVRRUXINFAXQJCI(_g , _p , x , y , w , h); +} +extern "C" void IUZYTSEZONUWTWFMFAUZZBSIJFAKGTNMQHGJCDLUMBXIBUMJEZQSCXYGCRONRUSV(IntPtr _g , IntPtr _b , float x , float y); +inline static void System_Drawing_Graphics_DrawBitmap(IntPtr _g , IntPtr _b , float x , float y) +{ + IUZYTSEZONUWTWFMFAUZZBSIJFAKGTNMQHGJCDLUMBXIBUMJEZQSCXYGCRONRUSV(_g , _b , x , y); +} +extern "C" void ZHGMPWJCOAMYEKGPTQFGDUKTJZGKOXCSIBIUNATIQNEBKZCSKZUBOLSEWNDQPYOQ(IntPtr _g , IntPtr _b , float x , float y , float w , float h); +inline static void System_Drawing_Graphics_DrawBitmapI(IntPtr _g , IntPtr _b , float x , float y , float w , float h) +{ + ZHGMPWJCOAMYEKGPTQFGDUKTJZGKOXCSIBIUNATIQNEBKZCSKZUBOLSEWNDQPYOQ(_g , _b , x , y , w , h); +} +extern "C" void LSQOWDFQETERJEXHKDIVSHEWEKCAHPMMLMSAQKEGREEWKERMVWXDRAHEOUJMAFIP(IntPtr _g , IntPtr _b , int x , int y , int w , int h , float x1 , float y1 , float w1 , float h1); +inline static void System_Drawing_Graphics_DrawBitmapII(IntPtr _g , IntPtr _b , int x , int y , int w , int h , float x1 , float y1 , float w1 , float h1) +{ + LSQOWDFQETERJEXHKDIVSHEWEKCAHPMMLMSAQKEGREEWKERMVWXDRAHEOUJMAFIP(_g , _b , x , y , w , h , x1 , y1 , w1 , h1); +} +extern "C" void XUPCBMCTWXQPQIIJXOAPDBEXJDXZWDTRZNEQJAQYWAEQVCONETSAYYNVPSSXPCWT(IntPtr _g , int argb); +inline static void System_Drawing_Graphics_Clear(IntPtr _g , int argb) +{ + XUPCBMCTWXQPQIIJXOAPDBEXJDXZWDTRZNEQJAQYWAEQVCONETSAYYNVPSSXPCWT(_g , argb); +} +extern "C" void EZPCESZWXBSCXNBGPJUCKSSBAIARITJUEKMVNLJMUWCXGKYCQLIFHTILGOCWSINE(const char* _s , IntPtr _g , IntPtr _p , IntPtr _f , float x , float y); +inline static void System_Drawing_Graphics_DrawString(const char* _s , IntPtr _g , IntPtr _p , IntPtr _f , float x , float y) +{ + EZPCESZWXBSCXNBGPJUCKSSBAIARITJUEKMVNLJMUWCXGKYCQLIFHTILGOCWSINE(_s , _g , _p , _f , x , y); +} +extern "C" _SizeF SEDSDCODJMYFIJHUAQTVFRIDPNHWEJTKZTWIZTVIKPEETOKASXTHSAGBVZCPUSZZ(const char* _s , IntPtr _g , IntPtr _f); +inline static _SizeF System_Drawing_Graphics_MeasureString(const char* _s , IntPtr _g , IntPtr _f) +{ + return SEDSDCODJMYFIJHUAQTVFRIDPNHWEJTKZTWIZTVIKPEETOKASXTHSAGBVZCPUSZZ(_s , _g , _f); +} + +extern "C" IntPtr OXTYBKQOPUFCEDFEGWYIYWRRLRDCYNQXILAWKYAODRHRKCYZEBRNPIRRFCMJHOPC(IntPtr handle); +inline static IntPtr System_Net_Sockets_Socket_NewI(IntPtr handle) +{ + return OXTYBKQOPUFCEDFEGWYIYWRRLRDCYNQXILAWKYAODRHRKCYZEBRNPIRRFCMJHOPC(handle); +} +extern "C" IntPtr DPFKNDZOGBPLKDWKHLMHADYJYKDOFECUNMBOERSRECWPCVRWXPLHAPFZRVMCALIC(SocketType socketType , ProtocolType protocolType); +inline static IntPtr System_Net_Sockets_Socket_NewII(SocketType socketType , ProtocolType protocolType) +{ + return DPFKNDZOGBPLKDWKHLMHADYJYKDOFECUNMBOERSRECWPCVRWXPLHAPFZRVMCALIC(socketType , protocolType); +} +extern "C" bool CJEMSAEAMDHWHNMAJPUVGYABKMFZCVDMLJECCGPOFIGQKNVOMQQWDPXEJCCFVFYR(); +inline static bool System_Net_Sockets_Socket_SupportsIPv4() +{ + return CJEMSAEAMDHWHNMAJPUVGYABKMFZCVDMLJECCGPOFIGQKNVOMQQWDPXEJCCFVFYR(); +} +extern "C" bool ZVLXIJXDZFQXRJRWRQMLFHIVMZTZDJTZKPQOCXFDTMWXZZMZLGOETMLSMPLJPXZP(); +inline static bool System_Net_Sockets_Socket_SupportsIPv6() +{ + return ZVLXIJXDZFQXRJRWRQMLFHIVMZTZDJTZKPQOCXFDTMWXZZMZLGOETMLSMPLJPXZP(); +} +extern "C" bool MQNBSCUTKJSSKLWNMTOXVOGXEYCMMWNVMHKIMLGJMUTKUTHBTYWWJCUYKPXUZHHO(); +inline static bool System_Net_Sockets_Socket_OSSupportsIPv6() +{ + return MQNBSCUTKJSSKLWNMTOXVOGXEYCMMWNVMHKIMLGJMUTKUTHBTYWWJCUYKPXUZHHO(); +} +extern "C" bool VXFDANABNEKAUWDKRBTOARLKNMYXOMJFNFOXNDAGXUIERTDOMMDYNSNELVQOODNA(); +inline static bool System_Net_Sockets_Socket_OSSupportsUnixDomainSockets() +{ + return VXFDANABNEKAUWDKRBTOARLKNMYXOMJFNFOXNDAGXUIERTDOMMDYNSNELVQOODNA(); +} +extern "C" bool VFNPHFXNANQFIHSTJKKBJKRURJMSNMRTHIILGNGGOPXABIWECWEESLRKOSYXTEAO(); +inline static bool System_Net_Sockets_Socket_OSSupportsIPv4() +{ + return VFNPHFXNANQFIHSTJKKBJKRURJMSNMRTHIILGNGGOPXABIWECWEESLRKOSYXTEAO(); +} +extern "C" char* VXYAYHNVDEMTMQSJNHQQHNBVQYWNPIMKPJFEJVGVJIANYXYYZOKMOKGIVCJAKAGV(IntPtr s); +inline static char* System_Net_Sockets_Socket_RemoteEndPoint(IntPtr s) +{ + return VXYAYHNVDEMTMQSJNHQQHNBVQYWNPIMKPJFEJVGVJIANYXYYZOKMOKGIVCJAKAGV(s); +} +extern "C" IntPtr SCEDLNASBUHZMNXSZYNAYAVFCXJGLFLICFVVTVNLORKUCHVIFRALMFWSHZANETGV(IntPtr s); +inline static IntPtr System_Net_Sockets_Socket_Handle(IntPtr s) +{ + return SCEDLNASBUHZMNXSZYNAYAVFCXJGLFLICFVVTVNLORKUCHVIFRALMFWSHZANETGV(s); +} +extern "C" bool JYWHRBZELBMGPBCVBAAUFZWWIDOTUZHVLOKEKOQERVAKTQCFXFMETLQJBZZOMGJM(IntPtr s); +inline static bool System_Net_Sockets_Socket_Connected(IntPtr s) +{ + return JYWHRBZELBMGPBCVBAAUFZWWIDOTUZHVLOKEKOQERVAKTQCFXFMETLQJBZZOMGJM(s); +} +extern "C" int URVBQXKNJVDKZLDSAIWPMDBZYACKOBRKLOQCUAPZVYUXIGKQWHNEKUZRPWDPUZYI(IntPtr s); +inline static int System_Net_Sockets_Socket_Available(IntPtr s) +{ + return URVBQXKNJVDKZLDSAIWPMDBZYACKOBRKLOQCUAPZVYUXIGKQWHNEKUZRPWDPUZYI(s); +} +extern "C" bool ESYLVBXATWUOIEQRQMOHNNAROYMYXZEVAMTQIZUVKNKOZLIKFLZIKQUQRGWWOYCU(IntPtr s); +inline static bool System_Net_Sockets_Socket_Blocking(IntPtr s) +{ + return ESYLVBXATWUOIEQRQMOHNNAROYMYXZEVAMTQIZUVKNKOZLIKFLZIKQUQRGWWOYCU(s); +} +extern "C" void RYNWLAJRRSXADMRDQCTLZWLJRCYBDYHLKPXBXLYEBIQSTUMFOSFLERUUNEFJBINT(IntPtr s , bool v); +inline static void System_Net_Sockets_Socket_Blocking_Set(IntPtr s , bool v) +{ + RYNWLAJRRSXADMRDQCTLZWLJRCYBDYHLKPXBXLYEBIQSTUMFOSFLERUUNEFJBINT(s , v); +} +extern "C" bool LLPNPQGEDOKRGTQXPTMKSVHTVCNSGPCSUXGHFZPXLBHPGDOUOHTIVDBPEVSMDNYO(IntPtr s); +inline static bool System_Net_Sockets_Socket_DontFragment(IntPtr s) +{ + return LLPNPQGEDOKRGTQXPTMKSVHTVCNSGPCSUXGHFZPXLBHPGDOUOHTIVDBPEVSMDNYO(s); +} +extern "C" void LRWJMISQDOZRNRNROTDYWUXRVRCJGDUXCTEPHFIFPCFGEJBNIAYJJZRRUFNUFIJA(IntPtr s , bool v); +inline static void System_Net_Sockets_Socket_DontFragment_Set(IntPtr s , bool v) +{ + LRWJMISQDOZRNRNROTDYWUXRVRCJGDUXCTEPHFIFPCFGEJBNIAYJJZRRUFNUFIJA(s , v); +} +extern "C" bool UBOUNXKILXJUOQNLQPBFEKODCMUBSNAGSFMCVHZKQPYLPXDERBEQHDVJMLRACIQX(IntPtr s); +inline static bool System_Net_Sockets_Socket_DualMode(IntPtr s) +{ + return UBOUNXKILXJUOQNLQPBFEKODCMUBSNAGSFMCVHZKQPYLPXDERBEQHDVJMLRACIQX(s); +} +extern "C" void XDBJDKQIQQPOMCNFJQKQIKYOJDQKPYHHZAOMVTAHKVZQOHWKXMRMYZPNENZZUGTR(IntPtr s , bool v); +inline static void System_Net_Sockets_Socket_DualMode_Set(IntPtr s , bool v) +{ + XDBJDKQIQQPOMCNFJQKQIKYOJDQKPYHHZAOMVTAHKVZQOHWKXMRMYZPNENZZUGTR(s , v); +} +extern "C" void IHOLOBJPQDGMKHABGFMCHVJALAHHTAMECIHGSKWWCBVUTCDWNYSPURKNXOANUCWP(IntPtr s , bool v); +inline static void System_Net_Sockets_Socket_EnableBroadcast_Set(IntPtr s , bool v) +{ + IHOLOBJPQDGMKHABGFMCHVJALAHHTAMECIHGSKWWCBVUTCDWNYSPURKNXOANUCWP(s , v); +} +extern "C" void QBKBZTJWIQZFZOGIWKUVIXKLYUIDJJCAFGERSBXTPWGERFNJISQJHAHTRZDFKFMZ(IntPtr s , bool v); +inline static void System_Net_Sockets_Socket_ExclusiveAddressUse_Set(IntPtr s , bool v) +{ + QBKBZTJWIQZFZOGIWKUVIXKLYUIDJJCAFGERSBXTPWGERFNJISQJHAHTRZDFKFMZ(s , v); +} +extern "C" IntPtr NZZTKPPUNBGLQGTTHZVRSSTFZKZTYSIJKHQSFUYSCVWFUVCLFKXKJVGUFUTZPWWV(IntPtr s); +inline static IntPtr System_Net_Sockets_Socket_Accept(IntPtr s) +{ + return NZZTKPPUNBGLQGTTHZVRSSTFZKZTYSIJKHQSFUYSCVWFUVCLFKXKJVGUFUTZPWWV(s); +} +extern "C" void SWBIPBNNBDOWWNKEHONOUXAOAVMKAYDGZAMXTUVDWKJGHKYRJPRBIIBUVNIUPCMC(IntPtr s); +inline static void System_Net_Sockets_Socket_Close(IntPtr s) +{ + SWBIPBNNBDOWWNKEHONOUXAOAVMKAYDGZAMXTUVDWKJGHKYRJPRBIIBUVNIUPCMC(s); +} +extern "C" void ZHXVAMKNSKRJOUHQXUBLHBXQZSCGLBOUYGGZMCQWEDJYQRGBFSWUBAVYJGWIKDCQ(IntPtr s , int timeout); +inline static void System_Net_Sockets_Socket_Close(IntPtr s , int timeout) +{ + ZHXVAMKNSKRJOUHQXUBLHBXQZSCGLBOUYGGZMCQWEDJYQRGBFSWUBAVYJGWIKDCQ(s , timeout); +} +extern "C" void VXKHOHDUDEGDSZZHLBATEUSXLIQGFIMBBTCTGYMYOBQXTSFJGOWJCILBENWGRWPV(IntPtr s , const char* _host , int port); +inline static void System_Net_Sockets_Socket_Connect(IntPtr s , const char* host , int port) +{ + VXKHOHDUDEGDSZZHLBATEUSXLIQGFIMBBTCTGYMYOBQXTSFJGOWJCILBENWGRWPV(s , host , port); +} +extern "C" void SFBZXGBMOCEDDVDSCGZRLCYTHAOTCGHSMUEORGMANJVADIXJJDDKWXKPHHRWRHKH(IntPtr s , bool reuseSocket); +inline static void System_Net_Sockets_Socket_Disconnect(IntPtr s , bool reuseSocket) +{ + SFBZXGBMOCEDDVDSCGZRLCYTHAOTCGHSMUEORGMANJVADIXJJDDKWXKPHHRWRHKH(s , reuseSocket); +} +extern "C" void VMQJQPBVTZEBGYQZCFKYCWVPJOGJPPIFZOEQSOSTCIRXTJJJRRTMXMEZRAZBIRFD(IntPtr s); +inline static void System_Net_Sockets_Socket_Listen(IntPtr s) +{ + VMQJQPBVTZEBGYQZCFKYCWVPJOGJPPIFZOEQSOSTCIRXTJJJRRTMXMEZRAZBIRFD(s); +} +extern "C" void RYBSTAHOMQWUFXVAFXSYWWINKFYRPRKKDNGUHRQRJFAGPKUUEZWLZGHVQOINBQYU(IntPtr s , int backlog); +inline static void System_Net_Sockets_Socket_ListenI(IntPtr s , int backlog) +{ + RYBSTAHOMQWUFXVAFXSYWWINKFYRPRKKDNGUHRQRJFAGPKUUEZWLZGHVQOINBQYU(s , backlog); +} +extern "C" int FLQSRASOHBOQVBXZLEMPVZLWFLETJCPTGFAETCCDHHDYSQZPRICXDIZGATMGWYFF(IntPtr s , byte * buffer , int len , SocketFlags flg); +inline static int System_Net_Sockets_Socket_Receive(IntPtr s , byte* buffer , int len , SocketFlags flg) +{ + return FLQSRASOHBOQVBXZLEMPVZLWFLETJCPTGFAETCCDHHDYSQZPRICXDIZGATMGWYFF(s , buffer , len , flg); +} +extern "C" int LUKQATFJBIINVMEOMPCAASQXFUDAPWHICYMXGIOXCSVVALKNPXUHWEFTEMLFPFUF(IntPtr s , byte * buffer , int len); +inline static int System_Net_Sockets_Socket_Send(IntPtr s , byte* buffer , int len) +{ + return LUKQATFJBIINVMEOMPCAASQXFUDAPWHICYMXGIOXCSVVALKNPXUHWEFTEMLFPFUF(s , buffer , len); +} +extern "C" int TQIIWJYCOBTISALHONMXQJDZHTVSJUSQPZSSOTROOKPDHIWKQKISBSMJMJADOFST(IntPtr s , const char* ip , int port , byte * buffer , int len); +inline static int System_Net_Sockets_Socket_SendTo(IntPtr s , const char* ip , int port , byte* buffer , int len) +{ + return TQIIWJYCOBTISALHONMXQJDZHTVSJUSQPZSSOTROOKPDHIWKQKISBSMJMJADOFST(s , ip , port , buffer , len); +} +extern "C" void EDMAONTHFKNMCDVKPQTHCLWLNQOAUVXEZNTIUDPFLSKJOAKFSUDRDJITGAMXZSNK(IntPtr s , const char* ip , int port); +inline static void System_Net_Sockets_Socket_Bind(IntPtr s , const char* ip , int port) +{ + EDMAONTHFKNMCDVKPQTHCLWLNQOAUVXEZNTIUDPFLSKJOAKFSUDRDJITGAMXZSNK(s , ip , port); +} + + + diff --git a/PdbChecker/Native/TimeSpan.h b/PdbChecker/Native/TimeSpan.h new file mode 100644 index 0000000..f7749d5 --- /dev/null +++ b/PdbChecker/Native/TimeSpan.h @@ -0,0 +1,86 @@ +#pragma once +#include +struct TimeSpan +{ + INT64 _ticks; + + TimeSpan(INT64 ticks) + { + _ticks = ticks; + } + + TimeSpan(int hours, int minutes, int seconds) + { + INT64 num = (INT64)hours * 3600L + (INT64)minutes * 60L + seconds; + _ticks = num * 10000000; + } + + TimeSpan(int days, int hours, int minutes, int seconds) + { + INT64 num = ((INT64)days * 3600L * 24 + (INT64)hours * 3600L + (INT64)minutes * 60L + seconds) * 1000 + 0; + _ticks = num * 10000; + } + + TimeSpan(int days, int hours, int minutes, int seconds, int milliseconds) + { + INT64 num = ((INT64)days * 3600L * 24 + (INT64)hours * 3600L + (INT64)minutes * 60L + seconds) * 1000 + milliseconds; + _ticks = num * 10000; + } + + void Add(TimeSpan ts) + { + _ticks += ts._ticks; + } + + int Days() + { + return (int)(_ticks / 864000000000L); + } + int Hours() + { + return (int)(_ticks / 36000000000L % 24); + } + int Milliseconds() + { + return (int)(_ticks / 10000 % 1000); + } + int Minutes() + { + return (int)(_ticks / 600000000 % 60); + } + int Seconds() + { + return (int)(_ticks / 10000000 % 60); + } + double TotalDays() + { + return (double)_ticks * 1.1574074074074074E-12; + } + double TotalHours() + { + return (double)_ticks * 2.7777777777777777E-11; + } + double TotalMilliseconds() + { + double num = (double)_ticks * 0.0001; + if (num > 922337203685477.0) + { + return 922337203685477.0; + } + + if (num < -922337203685477.0) + { + return -922337203685477.0; + } + + return num; + } + double TotalMinutes() + { + return (double)_ticks * 1.6666666666666667E-09; + } + double TotalSeconds() + { + return (double)_ticks * 1E-07; + } +}; \ No newline at end of file diff --git a/PdbChecker/PdbChecker.cpp b/PdbChecker/PdbChecker.cpp new file mode 100644 index 0000000..4768058 --- /dev/null +++ b/PdbChecker/PdbChecker.cpp @@ -0,0 +1,871 @@ +#include "Http.hpp" +#include +#include +#include +#include +#include +#include +#include +#include +#pragma comment(lib, "urlmon.lib") + +//http://www.sym101.com/Symbols/QueryModuleStruct?ModuleName=ntkrnlmp.pdb&Guid=F55005B80C686C739E763E6CF2559D9F&Agent=1&StructName=_EPROCESS&FildName=ActiveProcessLinks +#include "_helper.h" +using namespace std; +/*预定义缓存的文件列表*/ +auto syspath = +{ +"C:\\Windows\\System32\\hidclass.sys", +"C:\\Windows\\System32\\hidparse.sys", +"C:\\Windows\\System32\\hidusb.sys", +"C:\\Windows\\System32\\win32k.sys", +"C:\\Windows\\System32\\win32kbase.sys", +"C:\\Windows\\System32\\win32kfull.sys", +"C:\\Windows\\System32\\win32kns.sys", +"C:\\Windows\\System32\\drivers\\1394ohci.sys", +"C:\\Windows\\System32\\drivers\\3ware.sys", +"C:\\Windows\\System32\\drivers\\acpi.sys", +"C:\\Windows\\System32\\drivers\\AcpiDev.sys", +"C:\\Windows\\System32\\drivers\\acpiex.sys", +"C:\\Windows\\System32\\drivers\\acpipagr.sys", +"C:\\Windows\\System32\\drivers\\acpipmi.sys", +"C:\\Windows\\System32\\drivers\\acpitime.sys", +"C:\\Windows\\System32\\drivers\\Acx01000.sys", +"C:\\Windows\\System32\\drivers\\adp80xx.sys", +"C:\\Windows\\System32\\drivers\\afd.sys", +"C:\\Windows\\System32\\drivers\\afunix.sys", +"C:\\Windows\\System32\\drivers\\agilevpn.sys", +"C:\\Windows\\System32\\drivers\\ahcache.sys", +"C:\\Windows\\System32\\drivers\\amdgpio2.sys", +"C:\\Windows\\System32\\drivers\\amdi2c.sys", +"C:\\Windows\\System32\\drivers\\amdk8.sys", +"C:\\Windows\\System32\\drivers\\amdppm.sys", +"C:\\Windows\\System32\\drivers\\amdsata.sys", +"C:\\Windows\\System32\\drivers\\amdsbs.sys", +"C:\\Windows\\System32\\drivers\\amdxata.sys", +"C:\\Windows\\System32\\drivers\\appid.sys", +"C:\\Windows\\System32\\drivers\\AppleSSD.sys", +"C:\\Windows\\System32\\drivers\\applockerfltr.sys", +"C:\\Windows\\System32\\drivers\\arcsas.sys", +"C:\\Windows\\System32\\drivers\\asyncmac.sys", +"C:\\Windows\\System32\\drivers\\atapi.sys", +"C:\\Windows\\System32\\drivers\\ataport.sys", +"C:\\Windows\\System32\\drivers\\bam.sys", +"C:\\Windows\\System32\\drivers\\battc.sys", +"C:\\Windows\\System32\\drivers\\bcmfn2.sys", +"C:\\Windows\\System32\\drivers\\beep.sys", +"C:\\Windows\\System32\\drivers\\bindflt.sys", +"C:\\Windows\\System32\\drivers\\bowser.sys", +"C:\\Windows\\System32\\drivers\\bridge.sys", +"C:\\Windows\\System32\\drivers\\BtaMPM.sys", +"C:\\Windows\\System32\\drivers\\BthA2dp.sys", +"C:\\Windows\\System32\\drivers\\bthenum.sys", +"C:\\Windows\\System32\\drivers\\BthHfAud.sys", +"C:\\Windows\\System32\\drivers\\BthHfEnum.sys", +"C:\\Windows\\System32\\drivers\\BthMini.SYS", +"C:\\Windows\\System32\\drivers\\bthmodem.sys", +"C:\\Windows\\System32\\drivers\\bthpan.sys", +"C:\\Windows\\System32\\drivers\\bthport.sys", +"C:\\Windows\\System32\\drivers\\BTHUSB.SYS", +"C:\\Windows\\System32\\drivers\\bttflt.sys", +"C:\\Windows\\System32\\drivers\\buttonconverter.sys", +"C:\\Windows\\System32\\drivers\\bxvbda.sys", +"C:\\Windows\\System32\\drivers\\CAD.sys", +"C:\\Windows\\System32\\drivers\\cdfs.sys", +"C:\\Windows\\System32\\drivers\\cdrom.sys", +"C:\\Windows\\System32\\drivers\\CEA.sys", +"C:\\Windows\\System32\\drivers\\cht4dx64.sys", +"C:\\Windows\\System32\\drivers\\cht4sx64.sys", +"C:\\Windows\\System32\\drivers\\cht4vfx.sys", +"C:\\Windows\\System32\\drivers\\cht4vx64.sys", +"C:\\Windows\\System32\\drivers\\cimfs.sys", +"C:\\Windows\\System32\\drivers\\circlass.sys", +"C:\\Windows\\System32\\drivers\\Classpnp.sys", +"C:\\Windows\\System32\\drivers\\cldflt.sys", +"C:\\Windows\\System32\\drivers\\clfs.sys", +"C:\\Windows\\System32\\drivers\\ClipSp.sys", +"C:\\Windows\\System32\\drivers\\CmBatt.sys", +"C:\\Windows\\System32\\drivers\\cmimcext.sys", +"C:\\Windows\\System32\\drivers\\cng.sys", +"C:\\Windows\\System32\\drivers\\cnghwassist.sys", +"C:\\Windows\\System32\\drivers\\condrv.sys", +"C:\\Windows\\System32\\drivers\\crashdmp.sys", +"C:\\Windows\\System32\\drivers\\CtiIo64.sys", +"C:\\Windows\\System32\\drivers\\dam.sys", +"C:\\Windows\\System32\\drivers\\Dbgv.sys", +"C:\\Windows\\System32\\drivers\\devauthe.sys", +"C:\\Windows\\System32\\drivers\\dfsc.sys", +"C:\\Windows\\System32\\drivers\\disk.sys", +"C:\\Windows\\System32\\drivers\\Diskdump.sys", +"C:\\Windows\\System32\\drivers\\Dmpusbstor.sys", +"C:\\Windows\\System32\\drivers\\dmvsc.sys", +"C:\\Windows\\System32\\drivers\\drmk.sys", +"C:\\Windows\\System32\\drivers\\drmkaud.sys", +"C:\\Windows\\System32\\drivers\\Dumpata.sys", +"C:\\Windows\\System32\\drivers\\dumpfve.sys", +"C:\\Windows\\System32\\drivers\\dumpsd.sys", +"C:\\Windows\\System32\\drivers\\dumpsdport.sys", +"C:\\Windows\\System32\\drivers\\Dumpstorport.sys", +"C:\\Windows\\System32\\drivers\\dxgkrnl.sys", +"C:\\Windows\\System32\\drivers\\dxgmms1.sys", +"C:\\Windows\\System32\\drivers\\dxgmms2.sys", +"C:\\Windows\\System32\\drivers\\e3xw10x64.sys", +"C:\\Windows\\System32\\drivers\\EhStorClass.sys", +"C:\\Windows\\System32\\drivers\\EhStorTcgDrv.sys", +"C:\\Windows\\System32\\drivers\\ene.sys", +"C:\\Windows\\System32\\drivers\\errdev.sys", +"C:\\Windows\\System32\\drivers\\evbd0a.sys", +"C:\\Windows\\System32\\drivers\\evbda.sys", +"C:\\Windows\\System32\\drivers\\ew_usbccgpfilter.sys", +"C:\\Windows\\System32\\drivers\\ExecutionContext.sys", +"C:\\Windows\\System32\\drivers\\exfat.sys", +"C:\\Windows\\System32\\drivers\\fastfat.sys", +"C:\\Windows\\System32\\drivers\\fdc.sys", +"C:\\Windows\\System32\\drivers\\filecrypt.sys", +"C:\\Windows\\System32\\drivers\\fileinfo.sys", +"C:\\Windows\\System32\\drivers\\filetrace.sys", +"C:\\Windows\\System32\\drivers\\flpydisk.sys", +"C:\\Windows\\System32\\drivers\\fltMgr.sys", +"C:\\Windows\\System32\\drivers\\fs_rec.sys", +"C:\\Windows\\System32\\drivers\\fsdepends.sys", +"C:\\Windows\\System32\\drivers\\fvevol.sys", +"C:\\Windows\\System32\\drivers\\FWPKCLNT.SYS", +"C:\\Windows\\System32\\drivers\\gpuenergydrv.sys", +"C:\\Windows\\System32\\drivers\\hcmon.sys", +"C:\\Windows\\System32\\drivers\\hdaudbus.sys", +"C:\\Windows\\System32\\drivers\\HdAudio.sys", +"C:\\Windows\\System32\\drivers\\hidbatt.sys", +"C:\\Windows\\System32\\drivers\\hidbth.sys", +"C:\\Windows\\System32\\drivers\\hidclass.sys", +"C:\\Windows\\System32\\drivers\\hidi2c.sys", +"C:\\Windows\\System32\\drivers\\hidinterrupt.sys", +"C:\\Windows\\System32\\drivers\\hidir.sys", +"C:\\Windows\\System32\\drivers\\hidparse.sys", +"C:\\Windows\\System32\\drivers\\hidspi.sys", +"C:\\Windows\\System32\\drivers\\HidSpiCx.sys", +"C:\\Windows\\System32\\drivers\\hidusb.sys", +"C:\\Windows\\System32\\drivers\\HpSAMD.sys", +"C:\\Windows\\System32\\drivers\\Hsp.sys", +"C:\\Windows\\System32\\drivers\\http.sys", +"C:\\Windows\\System32\\drivers\\hvcrash.sys", +"C:\\Windows\\System32\\drivers\\hvservice.sys", +"C:\\Windows\\System32\\drivers\\hvsocket.sys", +"C:\\Windows\\System32\\drivers\\hw_cdcacm.sys", +"C:\\Windows\\System32\\drivers\\hw_quusbmdm.sys", +"C:\\Windows\\System32\\drivers\\hw_quusbnet.sys", +"C:\\Windows\\System32\\drivers\\hw_usbdev.sys", +"C:\\Windows\\System32\\drivers\\hwpolicy.sys", +"C:\\Windows\\System32\\drivers\\hyperkbd.sys", +"C:\\Windows\\System32\\drivers\\HyperVideo.sys", +"C:\\Windows\\System32\\drivers\\i8042prt.sys", +"C:\\Windows\\System32\\drivers\\iagpio.sys", +"C:\\Windows\\System32\\drivers\\iai2c.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_GPIO2.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_GPIO2_BXT_P.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_GPIO2_CNL.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_GPIO2_GLK.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_I2C.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_I2C_BXT_P.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_I2C_CNL.sys", +"C:\\Windows\\System32\\drivers\\iaLPSS2i_I2C_GLK.sys", +"C:\\Windows\\System32\\drivers\\iaLPSSi_GPIO.sys", +"C:\\Windows\\System32\\drivers\\iaLPSSi_I2C.sys", +"C:\\Windows\\System32\\drivers\\iaStorAVC.sys", +"C:\\Windows\\System32\\drivers\\iaStorV.sys", +"C:\\Windows\\System32\\drivers\\ibbus.sys", +"C:\\Windows\\System32\\drivers\\IndirectKmd.sys", +"C:\\Windows\\System32\\drivers\\intelide.sys", +"C:\\Windows\\System32\\drivers\\intelpep.sys", +"C:\\Windows\\System32\\drivers\\intelpmax.sys", +"C:\\Windows\\System32\\drivers\\IntelPMT.sys", +"C:\\Windows\\System32\\drivers\\intelppm.sys", +"C:\\Windows\\System32\\drivers\\iorate.sys", +"C:\\Windows\\System32\\drivers\\ipfltdrv.sys", +"C:\\Windows\\System32\\drivers\\IPMIDrv.sys", +"C:\\Windows\\System32\\drivers\\ipnat.sys", +"C:\\Windows\\System32\\drivers\\ipt.sys", +"C:\\Windows\\System32\\drivers\\isapnp.sys", +"C:\\Windows\\System32\\drivers\\ItSas35i.sys", +"C:\\Windows\\System32\\drivers\\kbdclass.sys", +"C:\\Windows\\System32\\drivers\\kbdhid.sys", +"C:\\Windows\\System32\\drivers\\kdnic.sys", +"C:\\Windows\\System32\\drivers\\kmpdc.sys", +"C:\\Windows\\System32\\drivers\\KNetPwrDepBroker.sys", +"C:\\Windows\\System32\\drivers\\ks.sys", +"C:\\Windows\\System32\\drivers\\ksecdd.sys", +"C:\\Windows\\System32\\drivers\\ksecpkg.sys", +"C:\\Windows\\System32\\drivers\\ksthunk.sys", +"C:\\Windows\\System32\\drivers\\lltdio.sys", +"C:\\Windows\\System32\\drivers\\lsi_sas.sys", +"C:\\Windows\\System32\\drivers\\lsi_sas2i.sys", +"C:\\Windows\\System32\\drivers\\lsi_sas3i.sys", +"C:\\Windows\\System32\\drivers\\luafv.sys", +"C:\\Windows\\System32\\drivers\\lxcore.sys", +"C:\\Windows\\System32\\drivers\\lxss.sys", +"C:\\Windows\\System32\\drivers\\mausbhost.sys", +"C:\\Windows\\System32\\drivers\\mausbip.sys", +"C:\\Windows\\System32\\drivers\\MbbCx.sys", +"C:\\Windows\\System32\\drivers\\mcd.sys", +"C:\\Windows\\System32\\drivers\\MegaSas2i.sys", +"C:\\Windows\\System32\\drivers\\megasas35i.sys", +"C:\\Windows\\System32\\drivers\\megasr.sys", +"C:\\Windows\\System32\\drivers\\Microsoft.Bluetooth.AvrcpTransport.sys", +"C:\\Windows\\System32\\drivers\\Microsoft.Bluetooth.Legacy.LEEnumerator.sys", +"C:\\Windows\\System32\\drivers\\mlx4_bus.sys", +"C:\\Windows\\System32\\drivers\\mmcss.sys", +"C:\\Windows\\System32\\drivers\\modem.sys", +"C:\\Windows\\System32\\drivers\\monitor.sys", +"C:\\Windows\\System32\\drivers\\mouclass.sys", +"C:\\Windows\\System32\\drivers\\mouhid.sys", +"C:\\Windows\\System32\\drivers\\mountmgr.sys", +"C:\\Windows\\System32\\drivers\\mpi3drvi.sys", +"C:\\Windows\\System32\\drivers\\mpsdrv.sys", +"C:\\Windows\\System32\\drivers\\mrxdav.sys", +"C:\\Windows\\System32\\drivers\\mrxsmb.sys", +"C:\\Windows\\System32\\drivers\\mrxsmb10.sys", +"C:\\Windows\\System32\\drivers\\mrxsmb20.sys", +"C:\\Windows\\System32\\drivers\\msfs.sys", +"C:\\Windows\\System32\\drivers\\msgpioclx.sys", +"C:\\Windows\\System32\\drivers\\msgpiowin32.sys", +"C:\\Windows\\System32\\drivers\\mshidkmdf.sys", +"C:\\Windows\\System32\\drivers\\mshidumdf.sys", +"C:\\Windows\\System32\\drivers\\mshwnclx.sys", +"C:\\Windows\\System32\\drivers\\msihid.sys", +"C:\\Windows\\System32\\drivers\\MsIo64.sys", +"C:\\Windows\\System32\\drivers\\msisadrv.sys", +"C:\\Windows\\System32\\drivers\\msiscsi.sys", +"C:\\Windows\\System32\\drivers\\mskssrv.sys", +"C:\\Windows\\System32\\drivers\\mslldp.sys", +"C:\\Windows\\System32\\drivers\\mspclock.sys", +"C:\\Windows\\System32\\drivers\\mspqm.sys", +"C:\\Windows\\System32\\drivers\\msquic.sys", +"C:\\Windows\\System32\\drivers\\msrpc.sys", +"C:\\Windows\\System32\\drivers\\mssmbios.sys", +"C:\\Windows\\System32\\drivers\\mstee.sys", +"C:\\Windows\\System32\\drivers\\MTConfig.sys", +"C:\\Windows\\System32\\drivers\\mup.sys", +"C:\\Windows\\System32\\drivers\\mvumis.sys", +"C:\\Windows\\System32\\drivers\\Nahimic_Mirroring.sys", +"C:\\Windows\\System32\\drivers\\ndfltr.sys", +"C:\\Windows\\System32\\drivers\\ndis.sys", +"C:\\Windows\\System32\\drivers\\ndiscap.sys", +"C:\\Windows\\System32\\drivers\\NdisImPlatform.sys", +"C:\\Windows\\System32\\drivers\\ndistapi.sys", +"C:\\Windows\\System32\\drivers\\ndisuio.sys", +"C:\\Windows\\System32\\drivers\\NdisVirtualBus.sys", +"C:\\Windows\\System32\\drivers\\ndiswan.sys", +"C:\\Windows\\System32\\drivers\\NDKPerf.sys", +"C:\\Windows\\System32\\drivers\\NDKPing.sys", +"C:\\Windows\\System32\\drivers\\ndproxy.sys", +"C:\\Windows\\System32\\drivers\\Ndu.sys", +"C:\\Windows\\System32\\drivers\\NetAdapterCx.sys", +"C:\\Windows\\System32\\drivers\\netbios.sys", +"C:\\Windows\\System32\\drivers\\netbt.sys", +"C:\\Windows\\System32\\drivers\\netio.sys", +"C:\\Windows\\System32\\drivers\\netvsc.sys", +"C:\\Windows\\System32\\drivers\\Netwtw10.sys", +"C:\\Windows\\System32\\drivers\\npfs.sys", +"C:\\Windows\\System32\\drivers\\npsvctrig.sys", +"C:\\Windows\\System32\\drivers\\nsiproxy.sys", +"C:\\Windows\\System32\\drivers\\ntfs.sys", +"C:\\Windows\\System32\\drivers\\ntosext.sys", +"C:\\Windows\\System32\\drivers\\null.sys", +"C:\\Windows\\System32\\drivers\\nvdimm.sys", +"C:\\Windows\\System32\\drivers\\nvhda64v.sys", +"C:\\Windows\\System32\\drivers\\nvmedisk.sys", +"C:\\Windows\\System32\\drivers\\nvpcf.sys", +"C:\\Windows\\System32\\drivers\\nvraid.sys", +"C:\\Windows\\System32\\drivers\\nvstor.sys", +"C:\\Windows\\System32\\drivers\\nwifi.sys", +"C:\\Windows\\System32\\drivers\\p9rdr.sys", +"C:\\Windows\\System32\\drivers\\pacer.sys", +"C:\\Windows\\System32\\drivers\\parport.sys", +"C:\\Windows\\System32\\drivers\\partmgr.sys", +"C:\\Windows\\System32\\drivers\\pci.sys", +"C:\\Windows\\System32\\drivers\\pciide.sys", +"C:\\Windows\\System32\\drivers\\pciidex.sys", +"C:\\Windows\\System32\\drivers\\pcmcia.sys", +"C:\\Windows\\System32\\drivers\\pcw.sys", +"C:\\Windows\\System32\\drivers\\pdc.sys", +"C:\\Windows\\System32\\drivers\\PEAuth.sys", +"C:\\Windows\\System32\\drivers\\percsas2i.sys", +"C:\\Windows\\System32\\drivers\\percsas3i.sys", +"C:\\Windows\\System32\\drivers\\PktMon.sys", +"C:\\Windows\\System32\\drivers\\pmem.sys", +"C:\\Windows\\System32\\drivers\\pnpmem.sys", +"C:\\Windows\\System32\\drivers\\portcfg.sys", +"C:\\Windows\\System32\\drivers\\portcls.sys", +"C:\\Windows\\System32\\drivers\\prjflt.sys", +"C:\\Windows\\System32\\drivers\\processr.sys", +"C:\\Windows\\System32\\drivers\\ProcLaunchMon.sys", +"C:\\Windows\\System32\\drivers\\qwavedrv.sys", +"C:\\Windows\\System32\\drivers\\ramdisk.sys", +"C:\\Windows\\System32\\drivers\\rasacd.sys", +"C:\\Windows\\System32\\drivers\\rasl2tp.sys", +"C:\\Windows\\System32\\drivers\\raspppoe.sys", +"C:\\Windows\\System32\\drivers\\raspptp.sys", +"C:\\Windows\\System32\\drivers\\rassstp.sys", +"C:\\Windows\\System32\\drivers\\rdbss.sys", +"C:\\Windows\\System32\\drivers\\rdpbus.sys", +"C:\\Windows\\System32\\drivers\\rdpdr.sys", +"C:\\Windows\\System32\\drivers\\rdpvideominiport.sys", +"C:\\Windows\\System32\\drivers\\rdyboost.sys", +"C:\\Windows\\System32\\drivers\\refs.sys", +"C:\\Windows\\System32\\drivers\\refsv1.sys", +"C:\\Windows\\System32\\drivers\\rfcomm.sys", +"C:\\Windows\\System32\\drivers\\rhproxy.sys", +"C:\\Windows\\System32\\drivers\\rmcast.sys", +"C:\\Windows\\System32\\drivers\\RNDISMP.sys", +"C:\\Windows\\System32\\drivers\\rootmdm.sys", +"C:\\Windows\\System32\\drivers\\rspndr.sys", +"C:\\Windows\\System32\\drivers\\rteth.sys", +"C:\\Windows\\System32\\drivers\\RTKVHD64.sys", +"C:\\Windows\\System32\\drivers\\RtsPer.sys", +"C:\\Windows\\System32\\drivers\\sbp2port.sys", +"C:\\Windows\\System32\\drivers\\scfilter.sys", +"C:\\Windows\\System32\\drivers\\scmbus.sys", +"C:\\Windows\\System32\\drivers\\scsiport.sys", +"C:\\Windows\\System32\\drivers\\sdbus.sys", +"C:\\Windows\\System32\\drivers\\SDFRd.sys", +"C:\\Windows\\System32\\drivers\\sdport.sys", +"C:\\Windows\\System32\\drivers\\sdstor.sys", +"C:\\Windows\\System32\\drivers\\SerCx.sys", +"C:\\Windows\\System32\\drivers\\SerCx2.sys", +"C:\\Windows\\System32\\drivers\\serenum.sys", +"C:\\Windows\\System32\\drivers\\serial.sys", +"C:\\Windows\\System32\\drivers\\sermouse.sys", +"C:\\Windows\\System32\\drivers\\sfloppy.sys", +"C:\\Windows\\System32\\drivers\\SgrmAgent.sys", +"C:\\Windows\\System32\\drivers\\sisraid2.sys", +"C:\\Windows\\System32\\drivers\\sisraid4.sys", +"C:\\Windows\\System32\\drivers\\SleepStudyHelper.sys", +"C:\\Windows\\System32\\drivers\\SmartSAMD.sys", +"C:\\Windows\\System32\\drivers\\smclib.sys", +"C:\\Windows\\System32\\drivers\\spacedump.sys", +"C:\\Windows\\System32\\drivers\\spaceparser.sys", +"C:\\Windows\\System32\\drivers\\spaceport.sys", +"C:\\Windows\\System32\\drivers\\SpatialGraphFilter.sys", +"C:\\Windows\\System32\\drivers\\SpbCx.sys", +"C:\\Windows\\System32\\drivers\\srv2.sys", +"C:\\Windows\\System32\\drivers\\srvnet.sys", +"C:\\Windows\\System32\\drivers\\ssbthid.sys", +"C:\\Windows\\System32\\drivers\\ssdevfactory.sys", +"C:\\Windows\\System32\\drivers\\sshid.sys", +"C:\\Windows\\System32\\drivers\\ssps2.sys", +"C:\\Windows\\System32\\drivers\\stexstor.sys", +"C:\\Windows\\System32\\drivers\\storahci.sys", +"C:\\Windows\\System32\\drivers\\stornvme.sys", +"C:\\Windows\\System32\\drivers\\storport.sys", +"C:\\Windows\\System32\\drivers\\storqosflt.sys", +"C:\\Windows\\System32\\drivers\\storufs.sys", +"C:\\Windows\\System32\\drivers\\storvsc.sys", +"C:\\Windows\\System32\\drivers\\stream.sys", +"C:\\Windows\\System32\\drivers\\STTub30.sys", +"C:\\Windows\\System32\\drivers\\tape.sys", +"C:\\Windows\\System32\\drivers\\tbs.sys", +"C:\\Windows\\System32\\drivers\\TbtBusDrv.sys", +"C:\\Windows\\System32\\drivers\\tcpip.sys", +"C:\\Windows\\System32\\drivers\\tcpipreg.sys", +"C:\\Windows\\System32\\drivers\\tdi.sys", +"C:\\Windows\\System32\\drivers\\tdx.sys", +"C:\\Windows\\System32\\drivers\\terminpt.sys", +"C:\\Windows\\System32\\drivers\\tm.sys", +"C:\\Windows\\System32\\drivers\\tpm.sys", +"C:\\Windows\\System32\\drivers\\TsUsbFlt.sys", +"C:\\Windows\\System32\\drivers\\TsUsbGD.sys", +"C:\\Windows\\System32\\drivers\\tunnel.sys", +"C:\\Windows\\System32\\drivers\\uaspstor.sys", +"C:\\Windows\\System32\\drivers\\UcmCx.sys", +"C:\\Windows\\System32\\drivers\\UcmTcpciCx.sys", +"C:\\Windows\\System32\\drivers\\UcmUcsiAcpiClient.sys", +"C:\\Windows\\System32\\drivers\\UcmUcsiCx.sys", +"C:\\Windows\\System32\\drivers\\Ucx01000.sys", +"C:\\Windows\\System32\\drivers\\Udecx.sys", +"C:\\Windows\\System32\\drivers\\udfs.sys", +"C:\\Windows\\System32\\drivers\\ufx01000.sys", +"C:\\Windows\\System32\\drivers\\ufxsynopsys.sys", +"C:\\Windows\\System32\\drivers\\umpass.sys", +"C:\\Windows\\System32\\drivers\\urscx01000.sys", +"C:\\Windows\\System32\\drivers\\usb8023.sys", +"C:\\Windows\\System32\\drivers\\USBAUDIO.sys", +"C:\\Windows\\System32\\drivers\\usbaudio2.sys", +"C:\\Windows\\System32\\drivers\\USBCAMD2.sys", +"C:\\Windows\\System32\\drivers\\usbccgp.sys", +"C:\\Windows\\System32\\drivers\\usbcir.sys", +"C:\\Windows\\System32\\drivers\\usbd.sys", +"C:\\Windows\\System32\\drivers\\usbehci.sys", +"C:\\Windows\\System32\\drivers\\usbhub.sys", +"C:\\Windows\\System32\\drivers\\USBHUB3.SYS", +"C:\\Windows\\System32\\drivers\\usbohci.sys", +"C:\\Windows\\System32\\drivers\\UsbPmApi.sys", +"C:\\Windows\\System32\\drivers\\usbport.sys", +"C:\\Windows\\System32\\drivers\\usbprint.sys", +"C:\\Windows\\System32\\drivers\\usbser.sys", +"C:\\Windows\\System32\\drivers\\USBSTOR.SYS", +"C:\\Windows\\System32\\drivers\\usbuhci.sys", +"C:\\Windows\\System32\\drivers\\usbvideo.sys", +"C:\\Windows\\System32\\drivers\\USBXHCI.SYS", +"C:\\Windows\\System32\\drivers\\vdrvroot.sys", +"C:\\Windows\\System32\\drivers\\VerifierExt.sys", +"C:\\Windows\\System32\\drivers\\vhdmp.sys", +"C:\\Windows\\System32\\drivers\\vhf.sys", +"C:\\Windows\\System32\\drivers\\Vid.sys", +"C:\\Windows\\System32\\drivers\\videoprt.sys", +"C:\\Windows\\System32\\drivers\\vmbkmcl.sys", +"C:\\Windows\\System32\\drivers\\vmbkmclr.sys", +"C:\\Windows\\System32\\drivers\\vmbus.sys", +"C:\\Windows\\System32\\drivers\\VMBusHID.sys", +"C:\\Windows\\System32\\drivers\\vmci.sys", +"C:\\Windows\\System32\\drivers\\vmgencounter.sys", +"C:\\Windows\\System32\\drivers\\vmgid.sys", +"C:\\Windows\\System32\\drivers\\vmnet.sys", +"C:\\Windows\\System32\\drivers\\vmnetadapter.sys", +"C:\\Windows\\System32\\drivers\\vmnetbridge.sys", +"C:\\Windows\\System32\\drivers\\vmnetuserif.sys", +"C:\\Windows\\System32\\drivers\\vms3cap.sys", +"C:\\Windows\\System32\\drivers\\VmsProxy.sys", +"C:\\Windows\\System32\\drivers\\VmsProxyHNic.sys", +"C:\\Windows\\System32\\drivers\\vmstorfl.sys", +"C:\\Windows\\System32\\drivers\\vmswitch.sys", +"C:\\Windows\\System32\\drivers\\vmx86.sys", +"C:\\Windows\\System32\\drivers\\volmgr.sys", +"C:\\Windows\\System32\\drivers\\volmgrx.sys", +"C:\\Windows\\System32\\drivers\\volsnap.sys", +"C:\\Windows\\System32\\drivers\\volume.sys", +"C:\\Windows\\System32\\drivers\\vpci.sys", +"C:\\Windows\\System32\\drivers\\vsmraid.sys", +"C:\\Windows\\System32\\drivers\\vsock.sys", +"C:\\Windows\\System32\\drivers\\VSTXRAID.SYS", +"C:\\Windows\\System32\\drivers\\vwifibus.sys", +"C:\\Windows\\System32\\drivers\\vwififlt.sys", +"C:\\Windows\\System32\\drivers\\vwifimp.sys", +"C:\\Windows\\System32\\drivers\\wacompen.sys", +"C:\\Windows\\System32\\drivers\\wanarp.sys", +"C:\\Windows\\System32\\drivers\\watchdog.sys", +"C:\\Windows\\System32\\drivers\\wcifs.sys", +"C:\\Windows\\System32\\drivers\\WdBoot.sys", +"C:\\Windows\\System32\\drivers\\WdDevFlt.sys", +"C:\\Windows\\System32\\drivers\\Wdf01000.sys", +"C:\\Windows\\System32\\drivers\\WdFilter.sys", +"C:\\Windows\\System32\\drivers\\WdfLdr.sys", +"C:\\Windows\\System32\\drivers\\WdiWiFi.sys", +"C:\\Windows\\System32\\drivers\\WdmCompanionFilter.sys", +"C:\\Windows\\System32\\drivers\\WdNisDrv.sys", +"C:\\Windows\\System32\\drivers\\werkernel.sys", +"C:\\Windows\\System32\\drivers\\wfplwfs.sys", +"C:\\Windows\\System32\\drivers\\WifiCx.sys", +"C:\\Windows\\System32\\drivers\\wimmount.sys", +"C:\\Windows\\System32\\drivers\\WindowsTrustedRT.sys", +"C:\\Windows\\System32\\drivers\\WindowsTrustedRTProxy.sys", +"C:\\Windows\\System32\\drivers\\winhv.sys", +"C:\\Windows\\System32\\drivers\\winhvr.sys", +"C:\\Windows\\System32\\drivers\\winmad.sys", +"C:\\Windows\\System32\\drivers\\winnat.sys", +"C:\\Windows\\System32\\drivers\\winusb.sys", +"C:\\Windows\\System32\\drivers\\winverbs.sys", +"C:\\Windows\\System32\\drivers\\wmiacpi.sys", +"C:\\Windows\\System32\\drivers\\wmilib.sys", +"C:\\Windows\\System32\\drivers\\wof.sys", +"C:\\Windows\\System32\\drivers\\WpdUpFltr.sys", +"C:\\Windows\\System32\\drivers\\WppRecorder.sys", +"C:\\Windows\\System32\\drivers\\ws2ifsl.sys", +"C:\\Windows\\System32\\drivers\\WUDFPf.sys", +"C:\\Windows\\System32\\drivers\\WUDFRd.sys", +"C:\\Windows\\System32\\drivers\\xboxgip.sys", +"C:\\Windows\\System32\\drivers\\xinputhid.sys", + +"C:\\Windows\\System32\\ntoskrnl.exe", +"C:\\Windows\\System32\\dwm.exe", +"C:\\Windows\\System32\\dwmcore.dll", +"C:\\Windows\\System32\\dwmscene.dll", +"C:\\Windows\\System32\\uDWM.dll", +"C:\\Windows\\System32\\rdsdwmdr.dll", +"C:\\Windows\\System32\\dwmredir.dll", +"C:\\Windows\\System32\\dwmapi.dll", +"C:\\Windows\\System32\\dwm.exe", +"C:\\Windows\\System32\\dwminit.dll", +"C:\\Windows\\System32\\dwmghost.dll", +"C:\\Windows\\System32\\dxgi.dll", +"C:\\Windows\\System32\\dxgwdi.dll", +"C:\\Windows\\System32\\DXGIDebug.dll", +"C:\\Windows\\System32\\lsass.exe", +"C:\\Windows\\System32\\csrss.exe", +"C:\\Windows\\explorer.exe", +"C:\\Windows\\System32\\d2d1.dll", +"C:\\Windows\\System32\\DWrite.dll", +"C:\\Windows\\System32\\d3d10.dll", +"C:\\Windows\\System32\\d3d10_1.dll", +"C:\\Windows\\System32\\d3d10_1core.dll", +"C:\\Windows\\System32\\d3d10core.dll", +"C:\\Windows\\System32\\d3d10level9.dll", +"C:\\Windows\\System32\\d3d10ref.dll", +"C:\\Windows\\System32\\d3d10sdklayers.dll", +"C:\\Windows\\System32\\d3d10warp.dll", +"C:\\Windows\\System32\\d3d11.dll", +"C:\\Windows\\System32\\d3d11_3SDKLayers.dll", +"C:\\Windows\\System32\\d3d11on12.dll", +"C:\\Windows\\System32\\D3D12.dll", +"C:\\Windows\\System32\\D3D12Core.dll", +"C:\\Windows\\System32\\d3d12SDKLayers.dll", +"C:\\Windows\\System32\\d3d8thk.dll", +"C:\\Windows\\System32\\d3d9.dll", +"C:\\Windows\\System32\\d3d9on12.dll", +"C:\\Windows\\System32\\d3dconfig.exe", +"C:\\Windows\\System32\\d3dcsx_42.dll", +"C:\\Windows\\System32\\d3dcsx_43.dll", +"C:\\Windows\\System32\\d3dref9.dll", +"C:\\Windows\\System32\\D3DSCache.dll", +"C:\\Windows\\System32\\d3dx10.dll", +"C:\\Windows\\System32\\DXCore.dll" + +}; + +IMAGE_DEBUG_DIRECTORY_RAW GetPEHeaderInfo(const char* PEFileName) +{ + FILE* File = nullptr; + auto err = fopen_s(&File, PEFileName, "rb"); + if (err != 0) + { + return { 0 }; + } + IMAGE_DOS_HEADER DosHeader; + fread(&DosHeader, sizeof(IMAGE_DOS_HEADER), 1, File); + fseek(File, DosHeader.e_lfanew, SEEK_SET); + uint32_t NtHeadersSignature; + fread(&NtHeadersSignature, 4, 1, File); + + IMAGE_FILE_HEADER FileHeader; + fread(&FileHeader, sizeof(IMAGE_FILE_HEADER), 1, File); + + uint32_t is32BitHeader = FileHeader.Machine == IMAGE_FILE_MACHINE_I386; + + IMAGE_OPTIONAL_HEADER32 OptionalHeader32 = { 0 }; + IMAGE_OPTIONAL_HEADER64 OptionalHeader64 = { 0 }; + + if (is32BitHeader) + fread(&OptionalHeader32, sizeof(IMAGE_OPTIONAL_HEADER32), 1, File); + else + fread(&OptionalHeader64, sizeof(IMAGE_OPTIONAL_HEADER64), 1, File); + + uint32_t offDebug = 0; + uint32_t cbFromHeader = 0; + + uint32_t cbDebug = is32BitHeader ? + OptionalHeader32.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].Size : OptionalHeader64.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].Size; + + for (int HeaderNo = 0; HeaderNo < FileHeader.NumberOfSections; ++HeaderNo) { + IMAGE_SECTION_HEADER SectionHeader; + fread(&SectionHeader, sizeof(IMAGE_SECTION_HEADER), 1, File); + + if ((SectionHeader.PointerToRawData != 0) && (SectionHeader.SizeOfRawData != 0) && + (cbFromHeader < (SectionHeader.PointerToRawData + SectionHeader.SizeOfRawData))) { + cbFromHeader = SectionHeader.PointerToRawData + SectionHeader.SizeOfRawData; + } + + if (cbDebug != 0) { + if (is32BitHeader) { + if (SectionHeader.VirtualAddress <= OptionalHeader32.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].VirtualAddress && + ((SectionHeader.VirtualAddress + SectionHeader.SizeOfRawData) > OptionalHeader32.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].VirtualAddress)) { + offDebug = OptionalHeader32.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].VirtualAddress - SectionHeader.VirtualAddress + SectionHeader.PointerToRawData; + } + } + + else { + if (SectionHeader.VirtualAddress <= OptionalHeader64.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].VirtualAddress && + ((SectionHeader.VirtualAddress + SectionHeader.SizeOfRawData) > OptionalHeader64.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].VirtualAddress)) { + offDebug = OptionalHeader64.DataDirectory[IMAGE_DIRECTORY_ENTRY_DEBUG].VirtualAddress - SectionHeader.VirtualAddress + SectionHeader.PointerToRawData; + } + } + } + } + + fseek(File, offDebug, SEEK_SET); + + uint8_t loopexit = FALSE; + + IMAGE_DEBUG_DIRECTORY_RAW DebugRaw; + while (cbDebug >= sizeof(IMAGE_DEBUG_DIRECTORY)) { + + if (loopexit == FALSE) { + + IMAGE_DEBUG_DIRECTORY DebugDirectory; + + fread(&DebugDirectory, sizeof(IMAGE_DEBUG_DIRECTORY), 1, File); + + uint32_t seekPosition = ftell(File); + + if (DebugDirectory.Type == IMAGE_DEBUG_TYPE_CODEVIEW) { + fseek(File, DebugDirectory.PointerToRawData, SEEK_SET); + fread(&DebugRaw, sizeof(IMAGE_DEBUG_DIRECTORY_RAW), 1, File); + loopexit = TRUE; + + if (strstr((char*)DebugRaw.ImageName, ".ni.") != 0) { + fseek(File, seekPosition, SEEK_SET); + loopexit = FALSE; + } + } + + if ((DebugDirectory.PointerToRawData != 0) && (DebugDirectory.SizeOfData != 0) && + (cbFromHeader < (DebugDirectory.PointerToRawData + DebugDirectory.SizeOfData))) { + cbFromHeader = DebugDirectory.PointerToRawData + DebugDirectory.SizeOfData; + } + } + + cbDebug -= sizeof(IMAGE_DEBUG_DIRECTORY); + } + + fclose(File); + return DebugRaw; +} +void CheckPdb(const char* filepath) +{ + auto pe = GetPEHeaderInfo(filepath); + if (pe.PdbDbiAge == 0) return; + int errorcount = 0; +retry: + try + { + auto guid = pe.GuidString(); + int age = pe.PdbDbiAge; + char _url[2048]; + sprintf_s(_url, + "http://www.sym101.com/Symbols/SymbolCheck?ModuleName=%s&Guid=%s&Agent=%d", + (char*)pe.ImageName, + guid, + age + ); + auto dta = WebRequest(_url); + delete guid; + if (dta.size() > 0) + { + if ((char)dta[0] == '1') + { + cout << "[+] " << filepath << " -> " << (char*)pe.ImageName << " 缓存完毕 " << endl; + } + else if ((char)dta[0] == '0') + { + cout << "[*] " << filepath << " 不存在该文件的pdb " << endl; + } + else + { + cout << "[-] " << filepath << " -----------未知状态--------------------- " << endl; + } + } + else + { + cout << "[-] " << filepath << " 缓存失败 " << endl; + } + } + catch (const std::exception& e) + { + cout<< e.what() << endl; + if (errorcount++ < 10) + { + goto retry; + } + } +} +__int32 GetFileProcOffset(const char* filepath, const char* proc) +{ + auto pe = GetPEHeaderInfo(filepath); + if (pe.PdbDbiAge == 0) return -1; + int errorcount = 0; +retry: + try + { + auto guid = pe.GuidString(); + int age = pe.PdbDbiAge; + char _url[2048]; + sprintf_s(_url, + "http://www.sym101.com/Symbols/QueryModuleSymbol?ModuleName=%s&Guid=%s&Agent=%d&QueryName=%s", + (char*)pe.ImageName, + guid, + age, + proc + ); + auto dta = HttpRequest(_url); + delete guid; + if (dta.size() > 0) + { + return atoi((char*)dta.data()); + } + else + { + return -1; + } + } + catch (const std::exception& e) + { + cout << e.what() << endl; + if (errorcount++ < 10) + { + goto retry; + } + } + return -1; +} +int GetFileStructFildOffset(const char* filepath, const char* structname, const char* fildname) +{ + auto pe = GetPEHeaderInfo(filepath); + if (pe.PdbDbiAge == 0) return -1; + int errorcount = 0; +retry: + try + { + auto guid = pe.GuidString(); + int age = pe.PdbDbiAge; + char _url[2048]; + sprintf_s(_url, + "http://www.sym101.com/Symbols/QueryModuleStructFildOffset?ModuleName=%s&Guid=%s&Agent=%d&StructName=%s&FildName=%s", + (char*)pe.ImageName, + guid, + age, + structname, + fildname + ); + auto dta = HttpRequest(_url); + delete guid; + if (dta.size() > 0) + { + return atoi((char*)dta.data()); + } + else + { + return -1; + } + } + catch (const std::exception& e) + { + cout << e.what() << endl; + if (errorcount++ < 10) + { + goto retry; + } + } + return -1; +} +vector GetFilePdb(const char* filepath) +{ + auto pe = GetPEHeaderInfo(filepath); + if (pe.PdbDbiAge == 0) return vector(); + int errorcount = 0; +retry: + try + { + auto guid = pe.GuidString(); + int age = pe.PdbDbiAge; + char _url[2048]; + //下载对应pdb文件,GZip将pdb文件压缩后再转换为HEX格式的字符串 + sprintf_s(_url, + "http://www.sym101.com/Symbols/SymbolDownLoad?ModuleName=%s&Guid=%s&Agent=%d", + (char*)pe.ImageName, + guid, + age + ); + auto dta = HttpRequest(_url); + delete guid; + if (dta.size() > 0) + { + auto hex=ParseHex((const char*)dta.data()); + return GDecompress(hex); + } + else + { + return vector(); + } + } + catch (const std::exception& e) + { + cout << e.what() << endl; + if (errorcount++ < 10) + { + goto retry; + } + } + return vector(); +} +//DownLoadPdb + +vector GetSysFile() +{ + int errorcount = 0; +retry: + try + { + char _url[] = "http://www.sym101.com/Users/FileDownLoad?Filename=kemode.sys"; + auto dta = HttpRequest(_url); + if (dta.size() > 0) + { + auto hex = ParseHex((const char*)dta.data()); + return GDecompress(hex); + } + else + { + return vector(); + } + } + catch (const std::exception& e) + { + cout << e.what() << endl; + if (errorcount++ < 10) + { + goto retry; + } + } + return vector(); +} + +vector GetSysFileGZ() +{ + int errorcount = 0; +retry: + try + { + char _url[] = "http://www.sym101.com/Users/FileDownLoadGZ?Filename=kemode.sys"; + auto dta = HttpRequest(_url); + if (dta.size() > 0) + { + auto hex = ParseHex((const char*)dta.data()); + return GDecompress(hex); + } + else + { + return vector(); + } + } + catch (const std::exception& e) + { + cout << e.what() << endl; + if (errorcount++ < 10) + { + goto retry; + } + } + return vector(); +} +void KeyDown(int v) +{ + cout << (PVOID)v << endl; +} +int main(int agec, char** agev) +{ + auto xbuffer = GetFilePdb("C:\\Battlestate Games\\EFT\\UnityPlayer.dll"); + if (agec < 2)//直接启动 + { + for (int i = 0; i < syspath.size(); i++) + { + auto buffer=GetFilePdb(syspath.begin()[i]); + cout << syspath.begin()[i] << "\t" << buffer.size() << endl; + } + cout << "所有文件缓存完毕 " << endl; + Sleep(1000); + return 0; + } + //拖放文件启动 + for (int i = 1; i < agec; i++) + { + CheckPdb(agev[i]); + } + cout << "所有文件缓存完毕 " << endl; + Sleep(1000); +} \ No newline at end of file diff --git a/PdbChecker/PdbChecker.vcxproj b/PdbChecker/PdbChecker.vcxproj new file mode 100644 index 0000000..2e33644 --- /dev/null +++ b/PdbChecker/PdbChecker.vcxproj @@ -0,0 +1,185 @@ + + + + + Debug + Win32 + + + Release + Win32 + + + Debug + x64 + + + Release + x64 + + + + 16.0 + Win32Proj + {bb78e585-c6e4-4da5-a622-e4182879747b} + PdbChecker + 10.0 + + + + Application + true + v143 + Unicode + + + Application + false + v143 + true + Unicode + + + Application + true + v143 + Unicode + + + Application + false + v143 + true + Unicode + + + + + + + + + + + + + + + + + + + + + true + + + false + + + true + + + false + + + + Level3 + false + WIN32;_DEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + MultiThreadedDebug + + + Console + true + ws2_32.lib;%(AdditionalDependencies) + + + + + Level3 + true + true + false + WIN32;NDEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + MultiThreaded + + + Console + true + true + true + ws2_32.lib;%(AdditionalDependencies) + + + + + Level3 + false + _DEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + MultiThreadedDebug + + + Console + true + ws2_32.lib;%(AdditionalDependencies) + + + + + Level3 + true + true + false + NDEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + stdcpp17 + MultiThreaded + + + Console + true + true + true + ws2_32.lib;%(AdditionalDependencies) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/PdbChecker/PdbChecker.vcxproj.filters b/PdbChecker/PdbChecker.vcxproj.filters new file mode 100644 index 0000000..1e69ccf --- /dev/null +++ b/PdbChecker/PdbChecker.vcxproj.filters @@ -0,0 +1,104 @@ + + + + + {4FC737F1-C7A5-4376-A066-2A32D752A2FF} + cpp;c;cc;cxx;c++;cppm;ixx;def;odl;idl;hpj;bat;asm;asmx + + + {93995380-89BD-4b04-88EB-625FBE52EBFB} + h;hh;hpp;hxx;h++;hm;inl;inc;ipp;xsd + + + {67DA6AB6-F800-4c08-8B7A-83BB121AAD01} + rc;ico;cur;bmp;dlg;rc2;rct;bin;rgs;gif;jpg;jpeg;jpe;resx;tiff;tif;png;wav;mfcribbon-ms + + + {65a44dc0-ce01-4e2c-be2d-7cdc756604ba} + + + + + 源文件 + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + + + 头文件 + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + zlib + + + 头文件 + + + + + zlib + + + \ No newline at end of file diff --git a/PdbChecker/_helper.h b/PdbChecker/_helper.h new file mode 100644 index 0000000..354aac0 --- /dev/null +++ b/PdbChecker/_helper.h @@ -0,0 +1,462 @@ +#pragma once +#include +#include +#include "zlib\zlib.h" +#include + + +#include +#include +#include +#pragma comment(lib, "urlmon.lib") +#pragma comment(lib, "Wininet.lib") + +using namespace std; +#ifndef _IMAGE_DEBUG_DIRECTORY_RAW_ +#define _IMAGE_DEBUG_DIRECTORY_RAW_ +typedef struct _IMAGE_DEBUG_DIRECTORY_RAW { + uint8_t format[4]; + uint8_t PdbSignature[16]; + uint32_t PdbDbiAge; + uint8_t ImageName[256]; + const char* GuidString() + { + char* buf = new char[128]; + sprintf(buf, "%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X", + this->PdbSignature[3], this->PdbSignature[2], + this->PdbSignature[1], this->PdbSignature[0], + this->PdbSignature[5], this->PdbSignature[4], + this->PdbSignature[7], this->PdbSignature[6], + this->PdbSignature[8], this->PdbSignature[9], + this->PdbSignature[10], this->PdbSignature[11], + this->PdbSignature[12], this->PdbSignature[13], + this->PdbSignature[14], this->PdbSignature[15] + ); + return buf; + } +} IMAGE_DEBUG_DIRECTORY_RAW, * PIMAGE_DEBUG_DIRECTORY_RAW; +#endif +static vector Compress(BYTE* buffer, int len) +{ + vector result = vector(); + uLong destLen = compressBound(len); + unsigned char* ostream = (unsigned char*)malloc(destLen); + int res = compress(ostream, &destLen, (const unsigned char*)buffer, len); + if (res == Z_BUF_ERROR) { + return result; + } + if (res == Z_MEM_ERROR) { + return result; + } + int ldx = result.size(); + result.resize(destLen); + memcpy(&result.operator[](ldx), ostream, destLen); + + return result; +} +static vector Decompress(BYTE* buffer, int len, int maxlen) +{ + uLong destLen = maxlen; + vector result = vector(); + BYTE* o2stream = new BYTE[maxlen]; + int des = uncompress(o2stream, &destLen, buffer, len); + result.resize(destLen); + memcpy(result.data(), o2stream, destLen); + + return result; +} +static vector GDecompress(vector compressedBytes) { + vector uncompressedBytes = vector(); + if (compressedBytes.size() == 0)return uncompressedBytes; + unsigned full_length = compressedBytes.size(); + unsigned half_length = compressedBytes.size() / 2; + + unsigned uncompLength = full_length; + char* uncomp = (char*)calloc(sizeof(char), uncompLength); + + z_stream strm; + strm.next_in = (Bytef*)compressedBytes.data(); + strm.avail_in = compressedBytes.size(); + strm.total_out = 0; + strm.zalloc = Z_NULL; + strm.zfree = Z_NULL; + + bool done = false; + + if (inflateInit2(&strm, (16 + MAX_WBITS)) != Z_OK) { + free(uncomp); + return uncompressedBytes; + } + + while (!done) { + if (strm.total_out >= uncompLength) { + char* uncomp2 = (char*)calloc(sizeof(char), uncompLength + half_length); + memcpy(uncomp2, uncomp, uncompLength); + uncompLength += half_length; + free(uncomp); + uncomp = uncomp2; + } + + strm.next_out = (Bytef*)(uncomp + strm.total_out); + strm.avail_out = uncompLength - strm.total_out; + int err = inflate(&strm, Z_SYNC_FLUSH); + if (err == Z_STREAM_END) done = true; + else if (err != Z_OK) { + break; + } + } + + if (inflateEnd(&strm) != Z_OK) { + free(uncomp); + return uncompressedBytes; + } + + for (size_t i = 0; i < strm.total_out; ++i) { + uncompressedBytes.push_back(uncomp[i]); + } + free(uncomp); + return uncompressedBytes; +} +static vector GCompress(vector input) +{ + vector res = vector(); + res.resize(input.size()); + z_stream zs; + zs.zalloc = Z_NULL; + zs.zfree = Z_NULL; + zs.opaque = Z_NULL; + zs.avail_in = (uInt)input.size(); + zs.next_in = (Bytef*)input.data(); + zs.avail_out = (uInt)input.size(); + zs.next_out = (Bytef*)res.data(); + deflateInit2(&zs, Z_DEFAULT_COMPRESSION, Z_DEFLATED, 15 | 16, 8, Z_DEFAULT_STRATEGY); + deflate(&zs, Z_FINISH); + deflateEnd(&zs); + res.resize(zs.total_out); + return res; +} +static vector GDecompress(BYTE* compressedBytes,ULONG len) { + vector uncompressedBytes = vector(); + if (len == 0)return uncompressedBytes; + unsigned full_length = len; + unsigned half_length = len / 2; + + unsigned uncompLength = full_length; + char* uncomp = (char*)calloc(sizeof(char), uncompLength); + + z_stream strm; + strm.next_in = compressedBytes; + strm.avail_in = len; + strm.total_out = 0; + strm.zalloc = Z_NULL; + strm.zfree = Z_NULL; + + bool done = false; + + if (inflateInit2(&strm, (16 + MAX_WBITS)) != Z_OK) { + free(uncomp); + return uncompressedBytes; + } + + while (!done) { + if (strm.total_out >= uncompLength) { + char* uncomp2 = (char*)calloc(sizeof(char), uncompLength + half_length); + memcpy(uncomp2, uncomp, uncompLength); + uncompLength += half_length; + free(uncomp); + uncomp = uncomp2; + } + + strm.next_out = (Bytef*)(uncomp + strm.total_out); + strm.avail_out = uncompLength - strm.total_out; + int err = inflate(&strm, Z_SYNC_FLUSH); + if (err == Z_STREAM_END) done = true; + else if (err != Z_OK) { + break; + } + } + + if (inflateEnd(&strm) != Z_OK) { + free(uncomp); + return uncompressedBytes; + } + + for (size_t i = 0; i < strm.total_out; ++i) { + uncompressedBytes.push_back(uncomp[i]); + } + free(uncomp); + return uncompressedBytes; +} +static vector GCompress(BYTE* input,ULONG len) +{ + vector res = vector(); + res.resize(len); + z_stream zs; + zs.zalloc = Z_NULL; + zs.zfree = Z_NULL; + zs.opaque = Z_NULL; + zs.avail_in = (uInt)len; + zs.next_in = (Bytef*)input; + zs.avail_out = (uInt)len; + zs.next_out = (Bytef*)res.data(); + deflateInit2(&zs, Z_DEFAULT_COMPRESSION, Z_DEFLATED, 15 | 16, 8, Z_DEFAULT_STRATEGY); + deflate(&zs, Z_FINISH); + deflateEnd(&zs); + res.resize(zs.total_out); + return res; +} +static vector GCompress(initializer_list input) +{ + return GCompress((BYTE*)input.begin(), input.size()); +} +static vector GCompress(initializer_list* input) +{ + return GCompress((BYTE*)input->begin(), input->size()); +} +static char* ToHex(const char* data, size_t len) +{ + const char* key = "0123456789ABCDEF"; + char* result = new char[len * 2]; + for (int i = 0; i < len; i++) + { + result[i * 2] = key[(BYTE)(data[i] >> 4)]; + result[(i * 2) + 1] = key[(BYTE)((BYTE)(data[i] << 4) >> 4)]; + } + return result; +} +static char* ToHex(const BYTE* data, size_t len) +{ + const char* key = "0123456789ABCDEF"; + char* result = new char[(len * 2) + 1]; + for (int i = 0; i < len; i++) + { + result[i * 2] = key[(BYTE)(data[i] >> 4)]; + result[(i * 2) + 1] = key[(BYTE)((BYTE)(data[i] << 4) >> 4)]; + } + result[len * 2] = '\0'; + return result; +} +static vector ParseHex(const char* hex) +{ + vector result = vector(); + int len = strlen(hex); + BYTE* buffer = new BYTE[len]; + bool ish = true; + BYTE val = 0; + for (int i = 0; i < len; i++) + { + bool isval = false; + BYTE v = 0; + if (hex[i] >= '0' && hex[i] <= '9') + { + v = (hex[i] - '0'); + isval = true; + } + else if (hex[i] >= 'A' && hex[i] <= 'F') + { + v = 10 + (hex[i] - 'A'); + isval = true; + } + else if (hex[i] >= 'a' && hex[i] <= 'f') + { + v = 10 + (hex[i] - 'a'); + isval = true; + } + if (isval) + { + if (ish) + { + val = (v << 4) | val; + } + else + { + val = v | val; + result.push_back(val); + val = 0; + } + ish = !ish; + } + } + return result; +} +static initializer_list* ReadAllBytes(const char* filePath) +{ + HANDLE pFile; + DWORD fileSize; + char* buffer, * tmpBuf; + DWORD dwBytesRead, dwBytesToRead, tmpLen; + + pFile = CreateFileA(filePath, + GENERIC_READ, + FILE_SHARE_READ, + NULL, + OPEN_EXISTING, + FILE_ATTRIBUTE_NORMAL, + NULL); + if (pFile == INVALID_HANDLE_VALUE) + { + CloseHandle(pFile); + return nullptr; + } + fileSize = GetFileSize(pFile, NULL); + buffer = (char*)malloc(fileSize); + if (!buffer) + { + return nullptr; + } + ZeroMemory(buffer, fileSize); + dwBytesToRead = fileSize; + dwBytesRead = 0; + tmpBuf = buffer; + do { + if (!ReadFile(pFile, tmpBuf, dwBytesToRead, &dwBytesRead, NULL) || dwBytesRead == 0) + break; + dwBytesToRead -= dwBytesRead; + tmpBuf += dwBytesRead; + + } while (dwBytesToRead > 0); + CloseHandle(pFile); + return new initializer_list((BYTE*)&buffer[0], (BYTE*)&buffer[fileSize]); +} +static BOOL WriteAllBytes(const char* filePath, char* buffer, int len) +{ + HANDLE pFile; + char* tmpBuf; + DWORD dwBytesWrite, dwBytesToWrite; + + pFile = CreateFileA(filePath, + GENERIC_WRITE, + 0, + NULL, + CREATE_ALWAYS, + FILE_ATTRIBUTE_NORMAL, + NULL); + + if (pFile == INVALID_HANDLE_VALUE) + { + CloseHandle(pFile); + return FALSE; + } + + dwBytesToWrite = len; + dwBytesWrite = 0; + + tmpBuf = buffer; + + do { + + WriteFile(pFile, tmpBuf, dwBytesToWrite, &dwBytesWrite, NULL); + + dwBytesToWrite -= dwBytesWrite; + tmpBuf += dwBytesWrite; + + } while (dwBytesToWrite > 0); + + CloseHandle(pFile); + + return TRUE; +} +static BOOL WriteAllBytes(const char* filePath, BYTE* buffer, int len) +{ + return WriteAllBytes(filePath,(char*)buffer,len); +} +static BOOL WriteAllBytes(const char* filePath, vector buffer) +{ + return WriteAllBytes(filePath, (char*)buffer.data(), buffer.size()); +} +static BOOL WriteAllBytes(const char* filePath, initializer_list buffer) +{ + return WriteAllBytes(filePath, (char*)buffer.begin(), buffer.size()); +} +static BOOL WriteAllBytes(const char* filePath, initializer_list* buffer) +{ + return WriteAllBytes(filePath, (char*)buffer->begin(), buffer->size()); +} +static BOOL WriteAllBytes(const char* filePath, initializer_list buffer) +{ + return WriteAllBytes(filePath, (char*)buffer.begin(), buffer.size()); +} +static BOOL WriteAllText(const char* filePath, const char* text) +{ + return WriteAllBytes(filePath, (char*)text, strlen(text)); +} +static vector HttpRequest(const char* url) +{ +#define MAXSIZE 4096 + vector result = vector(); + BYTE* val = new BYTE[MAXSIZE]; + ULONG len = 1; + HINTERNET hSession = InternetOpenA(NULL, INTERNET_OPEN_TYPE_PRECONFIG, NULL, NULL, 0); + if (hSession != NULL) + { + HINTERNET hHttp = InternetOpenUrlA(hSession, url, NULL, 0, INTERNET_FLAG_DONT_CACHE, 0); + + if (hHttp != NULL) + { + while (len > 0) + { + InternetReadFile(hHttp, val, MAXSIZE - 1, &len); + if (len > 0) + { + int ldx = result.size(); + result.resize(result.size() + len); + memcpy(&result.operator[](ldx), &val[0], len); + } + } + InternetCloseHandle(hHttp); + hHttp = NULL; + } + InternetCloseHandle(hSession); + hSession = NULL; + } + return result; +} +static string GetPathFolder(const char* path) +{ + int len = strlen(path); + char* res = new char[len]; + strcpy(res, path); + for (int i = len - 1; i >= 0; i--) + { + if (res[i] == '\\') + { + res[i] = '\0'; + break; + } + } + return res; +} +static string GetFileNameByPath(const char* path) +{ + int len = strlen(path); + char* res = new char[len]; + strcpy(res, path); + for (int i = len - 1; i >= 0; i--) + { + if (res[i] == '\\') + { + return &res[i+1]; + } + } + return res; +} +static string WebRequest(const char* url) +{ + IStream* stream; + HRESULT result = URLOpenBlockingStreamA(0, url, &stream, 0, 0); + if (result != 0) + { + return ""; + } + char buffer[4096]; + unsigned long bytesRead; + stringstream ss; + stream->Read(buffer, 4096, &bytesRead); + while (bytesRead > 0U) + { + ss.write(buffer, (long long)bytesRead); + stream->Read(buffer, 4096, &bytesRead); + } + stream->Release(); + return ss.str(); +} \ No newline at end of file diff --git a/PdbChecker/zlib/Makefile.am b/PdbChecker/zlib/Makefile.am new file mode 100644 index 0000000..d3b4df1 --- /dev/null +++ b/PdbChecker/zlib/Makefile.am @@ -0,0 +1,34 @@ +MAKEFLAGS := $(MAKEFLAGS) --no-builtin-rules + +ZLIB_SOURCE = \ + adler32.c \ + compress.c \ + crc32.c \ + uncompr.c \ + deflate.c \ + gzguts.h \ + trees.c \ + zutil.c \ + inflate.c \ + infback.c \ + inftrees.c \ + inffast.c \ + crc32.h \ + deflate.h \ + inffast.h \ + inffixed.h \ + inflate.h \ + inftrees.h \ + trees.h \ + zconf.h \ + zlib.h \ + zutil.h + +if !HAVE_SYS_ZLIB +if !HAVE_STATIC_ZLIB +noinst_LTLIBRARIES = libz.la +endif +endif + +libz_la_SOURCES = \ + $(ZLIB_SOURCE) diff --git a/PdbChecker/zlib/adler32.c b/PdbChecker/zlib/adler32.c new file mode 100644 index 0000000..d0be438 --- /dev/null +++ b/PdbChecker/zlib/adler32.c @@ -0,0 +1,186 @@ +/* adler32.c -- compute the Adler-32 checksum of a data stream + * Copyright (C) 1995-2011, 2016 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* @(#) $Id$ */ + +#include "zutil.h" + +local uLong adler32_combine_ OF((uLong adler1, uLong adler2, z_off64_t len2)); + +#define BASE 65521U /* largest prime smaller than 65536 */ +#define NMAX 5552 +/* NMAX is the largest n such that 255n(n+1)/2 + (n+1)(BASE-1) <= 2^32-1 */ + +#define DO1(buf,i) {adler += (buf)[i]; sum2 += adler;} +#define DO2(buf,i) DO1(buf,i); DO1(buf,i+1); +#define DO4(buf,i) DO2(buf,i); DO2(buf,i+2); +#define DO8(buf,i) DO4(buf,i); DO4(buf,i+4); +#define DO16(buf) DO8(buf,0); DO8(buf,8); + +/* use NO_DIVIDE if your processor does not do division in hardware -- + try it both ways to see which is faster */ +#ifdef NO_DIVIDE +/* note that this assumes BASE is 65521, where 65536 % 65521 == 15 + (thank you to John Reiser for pointing this out) */ +# define CHOP(a) \ + do { \ + unsigned long tmp = a >> 16; \ + a &= 0xffffUL; \ + a += (tmp << 4) - tmp; \ + } while (0) +# define MOD28(a) \ + do { \ + CHOP(a); \ + if (a >= BASE) a -= BASE; \ + } while (0) +# define MOD(a) \ + do { \ + CHOP(a); \ + MOD28(a); \ + } while (0) +# define MOD63(a) \ + do { /* this assumes a is not negative */ \ + z_off64_t tmp = a >> 32; \ + a &= 0xffffffffL; \ + a += (tmp << 8) - (tmp << 5) + tmp; \ + tmp = a >> 16; \ + a &= 0xffffL; \ + a += (tmp << 4) - tmp; \ + tmp = a >> 16; \ + a &= 0xffffL; \ + a += (tmp << 4) - tmp; \ + if (a >= BASE) a -= BASE; \ + } while (0) +#else +# define MOD(a) a %= BASE +# define MOD28(a) a %= BASE +# define MOD63(a) a %= BASE +#endif + +/* ========================================================================= */ +uLong ZEXPORT adler32_z(adler, buf, len) + uLong adler; + const Bytef *buf; + z_size_t len; +{ + unsigned long sum2; + unsigned n; + + /* split Adler-32 into component sums */ + sum2 = (adler >> 16) & 0xffff; + adler &= 0xffff; + + /* in case user likes doing a byte at a time, keep it fast */ + if (len == 1) { + adler += buf[0]; + if (adler >= BASE) + adler -= BASE; + sum2 += adler; + if (sum2 >= BASE) + sum2 -= BASE; + return adler | (sum2 << 16); + } + + /* initial Adler-32 value (deferred check for len == 1 speed) */ + if (buf == Z_NULL) + return 1L; + + /* in case short lengths are provided, keep it somewhat fast */ + if (len < 16) { + while (len--) { + adler += *buf++; + sum2 += adler; + } + if (adler >= BASE) + adler -= BASE; + MOD28(sum2); /* only added so many BASE's */ + return adler | (sum2 << 16); + } + + /* do length NMAX blocks -- requires just one modulo operation */ + while (len >= NMAX) { + len -= NMAX; + n = NMAX / 16; /* NMAX is divisible by 16 */ + do { + DO16(buf); /* 16 sums unrolled */ + buf += 16; + } while (--n); + MOD(adler); + MOD(sum2); + } + + /* do remaining bytes (less than NMAX, still just one modulo) */ + if (len) { /* avoid modulos if none remaining */ + while (len >= 16) { + len -= 16; + DO16(buf); + buf += 16; + } + while (len--) { + adler += *buf++; + sum2 += adler; + } + MOD(adler); + MOD(sum2); + } + + /* return recombined sums */ + return adler | (sum2 << 16); +} + +/* ========================================================================= */ +uLong ZEXPORT adler32(adler, buf, len) + uLong adler; + const Bytef *buf; + uInt len; +{ + return adler32_z(adler, buf, len); +} + +/* ========================================================================= */ +local uLong adler32_combine_(adler1, adler2, len2) + uLong adler1; + uLong adler2; + z_off64_t len2; +{ + unsigned long sum1; + unsigned long sum2; + unsigned rem; + + /* for negative len, return invalid adler32 as a clue for debugging */ + if (len2 < 0) + return 0xffffffffUL; + + /* the derivation of this formula is left as an exercise for the reader */ + MOD63(len2); /* assumes len2 >= 0 */ + rem = (unsigned)len2; + sum1 = adler1 & 0xffff; + sum2 = rem * sum1; + MOD(sum2); + sum1 += (adler2 & 0xffff) + BASE - 1; + sum2 += ((adler1 >> 16) & 0xffff) + ((adler2 >> 16) & 0xffff) + BASE - rem; + if (sum1 >= BASE) sum1 -= BASE; + if (sum1 >= BASE) sum1 -= BASE; + if (sum2 >= ((unsigned long)BASE << 1)) sum2 -= ((unsigned long)BASE << 1); + if (sum2 >= BASE) sum2 -= BASE; + return sum1 | (sum2 << 16); +} + +/* ========================================================================= */ +uLong ZEXPORT adler32_combine(adler1, adler2, len2) + uLong adler1; + uLong adler2; + z_off_t len2; +{ + return adler32_combine_(adler1, adler2, len2); +} + +uLong ZEXPORT adler32_combine64(adler1, adler2, len2) + uLong adler1; + uLong adler2; + z_off64_t len2; +{ + return adler32_combine_(adler1, adler2, len2); +} diff --git a/PdbChecker/zlib/compress.c b/PdbChecker/zlib/compress.c new file mode 100644 index 0000000..e2db404 --- /dev/null +++ b/PdbChecker/zlib/compress.c @@ -0,0 +1,86 @@ +/* compress.c -- compress a memory buffer + * Copyright (C) 1995-2005, 2014, 2016 Jean-loup Gailly, Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* @(#) $Id$ */ + +#define ZLIB_INTERNAL +#include "zlib.h" + +/* =========================================================================== + Compresses the source buffer into the destination buffer. The level + parameter has the same meaning as in deflateInit. sourceLen is the byte + length of the source buffer. Upon entry, destLen is the total size of the + destination buffer, which must be at least 0.1% larger than sourceLen plus + 12 bytes. Upon exit, destLen is the actual size of the compressed buffer. + + compress2 returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_BUF_ERROR if there was not enough room in the output buffer, + Z_STREAM_ERROR if the level parameter is invalid. +*/ +int ZEXPORT compress2 (dest, destLen, source, sourceLen, level) + Bytef *dest; + uLongf *destLen; + const Bytef *source; + uLong sourceLen; + int level; +{ + z_stream stream; + int err; + const uInt max = (uInt)-1; + uLong left; + + left = *destLen; + *destLen = 0; + + stream.zalloc = (alloc_func)0; + stream.zfree = (free_func)0; + stream.opaque = (voidpf)0; + + err = deflateInit(&stream, level); + if (err != Z_OK) return err; + + stream.next_out = dest; + stream.avail_out = 0; + stream.next_in = (z_const Bytef *)source; + stream.avail_in = 0; + + do { + if (stream.avail_out == 0) { + stream.avail_out = left > (uLong)max ? max : (uInt)left; + left -= stream.avail_out; + } + if (stream.avail_in == 0) { + stream.avail_in = sourceLen > (uLong)max ? max : (uInt)sourceLen; + sourceLen -= stream.avail_in; + } + err = deflate(&stream, sourceLen ? Z_NO_FLUSH : Z_FINISH); + } while (err == Z_OK); + + *destLen = stream.total_out; + deflateEnd(&stream); + return err == Z_STREAM_END ? Z_OK : err; +} + +/* =========================================================================== + */ +int ZEXPORT compress (dest, destLen, source, sourceLen) + Bytef *dest; + uLongf *destLen; + const Bytef *source; + uLong sourceLen; +{ + return compress2(dest, destLen, source, sourceLen, Z_DEFAULT_COMPRESSION); +} + +/* =========================================================================== + If the default memLevel or windowBits for deflateInit() is changed, then + this function needs to be updated. + */ +uLong ZEXPORT compressBound (sourceLen) + uLong sourceLen; +{ + return sourceLen + (sourceLen >> 12) + (sourceLen >> 14) + + (sourceLen >> 25) + 13; +} diff --git a/PdbChecker/zlib/crc32.c b/PdbChecker/zlib/crc32.c new file mode 100644 index 0000000..aa6b63c --- /dev/null +++ b/PdbChecker/zlib/crc32.c @@ -0,0 +1,442 @@ +/* crc32.c -- compute the CRC-32 of a data stream + * Copyright (C) 1995-2006, 2010, 2011, 2012, 2016 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + * + * Thanks to Rodney Brown for his contribution of faster + * CRC methods: exclusive-oring 32 bits of data at a time, and pre-computing + * tables for updating the shift register in one step with three exclusive-ors + * instead of four steps with four exclusive-ors. This results in about a + * factor of two increase in speed on a Power PC G4 (PPC7455) using gcc -O3. + */ + +/* @(#) $Id$ */ + +/* + Note on the use of DYNAMIC_CRC_TABLE: there is no mutex or semaphore + protection on the static variables used to control the first-use generation + of the crc tables. Therefore, if you #define DYNAMIC_CRC_TABLE, you should + first call get_crc_table() to initialize the tables before allowing more than + one thread to use crc32(). + + DYNAMIC_CRC_TABLE and MAKECRCH can be #defined to write out crc32.h. + */ + +#ifdef MAKECRCH +# include +# ifndef DYNAMIC_CRC_TABLE +# define DYNAMIC_CRC_TABLE +# endif /* !DYNAMIC_CRC_TABLE */ +#endif /* MAKECRCH */ + +#include "zutil.h" /* for STDC and FAR definitions */ + +/* Definitions for doing the crc four data bytes at a time. */ +#if !defined(NOBYFOUR) && defined(Z_U4) +# define BYFOUR +#endif +#ifdef BYFOUR + local unsigned long crc32_little OF((unsigned long, + const unsigned char FAR *, z_size_t)); + local unsigned long crc32_big OF((unsigned long, + const unsigned char FAR *, z_size_t)); +# define TBLS 8 +#else +# define TBLS 1 +#endif /* BYFOUR */ + +/* Local functions for crc concatenation */ +local unsigned long gf2_matrix_times OF((unsigned long *mat, + unsigned long vec)); +local void gf2_matrix_square OF((unsigned long *square, unsigned long *mat)); +local uLong crc32_combine_ OF((uLong crc1, uLong crc2, z_off64_t len2)); + + +#ifdef DYNAMIC_CRC_TABLE + +local volatile int crc_table_empty = 1; +local z_crc_t FAR crc_table[TBLS][256]; +local void make_crc_table OF((void)); +#ifdef MAKECRCH + local void write_table OF((FILE *, const z_crc_t FAR *)); +#endif /* MAKECRCH */ +/* + Generate tables for a byte-wise 32-bit CRC calculation on the polynomial: + x^32+x^26+x^23+x^22+x^16+x^12+x^11+x^10+x^8+x^7+x^5+x^4+x^2+x+1. + + Polynomials over GF(2) are represented in binary, one bit per coefficient, + with the lowest powers in the most significant bit. Then adding polynomials + is just exclusive-or, and multiplying a polynomial by x is a right shift by + one. If we call the above polynomial p, and represent a byte as the + polynomial q, also with the lowest power in the most significant bit (so the + byte 0xb1 is the polynomial x^7+x^3+x+1), then the CRC is (q*x^32) mod p, + where a mod b means the remainder after dividing a by b. + + This calculation is done using the shift-register method of multiplying and + taking the remainder. The register is initialized to zero, and for each + incoming bit, x^32 is added mod p to the register if the bit is a one (where + x^32 mod p is p+x^32 = x^26+...+1), and the register is multiplied mod p by + x (which is shifting right by one and adding x^32 mod p if the bit shifted + out is a one). We start with the highest power (least significant bit) of + q and repeat for all eight bits of q. + + The first table is simply the CRC of all possible eight bit values. This is + all the information needed to generate CRCs on data a byte at a time for all + combinations of CRC register values and incoming bytes. The remaining tables + allow for word-at-a-time CRC calculation for both big-endian and little- + endian machines, where a word is four bytes. +*/ +local void make_crc_table() +{ + z_crc_t c; + int n, k; + z_crc_t poly; /* polynomial exclusive-or pattern */ + /* terms of polynomial defining this crc (except x^32): */ + static volatile int first = 1; /* flag to limit concurrent making */ + static const unsigned char p[] = {0,1,2,4,5,7,8,10,11,12,16,22,23,26}; + + /* See if another task is already doing this (not thread-safe, but better + than nothing -- significantly reduces duration of vulnerability in + case the advice about DYNAMIC_CRC_TABLE is ignored) */ + if (first) { + first = 0; + + /* make exclusive-or pattern from polynomial (0xedb88320UL) */ + poly = 0; + for (n = 0; n < (int)(sizeof(p)/sizeof(unsigned char)); n++) + poly |= (z_crc_t)1 << (31 - p[n]); + + /* generate a crc for every 8-bit value */ + for (n = 0; n < 256; n++) { + c = (z_crc_t)n; + for (k = 0; k < 8; k++) + c = c & 1 ? poly ^ (c >> 1) : c >> 1; + crc_table[0][n] = c; + } + +#ifdef BYFOUR + /* generate crc for each value followed by one, two, and three zeros, + and then the byte reversal of those as well as the first table */ + for (n = 0; n < 256; n++) { + c = crc_table[0][n]; + crc_table[4][n] = ZSWAP32(c); + for (k = 1; k < 4; k++) { + c = crc_table[0][c & 0xff] ^ (c >> 8); + crc_table[k][n] = c; + crc_table[k + 4][n] = ZSWAP32(c); + } + } +#endif /* BYFOUR */ + + crc_table_empty = 0; + } + else { /* not first */ + /* wait for the other guy to finish (not efficient, but rare) */ + while (crc_table_empty) + ; + } + +#ifdef MAKECRCH + /* write out CRC tables to crc32.h */ + { + FILE *out; + + out = fopen("crc32.h", "w"); + if (out == NULL) return; + fprintf(out, "/* crc32.h -- tables for rapid CRC calculation\n"); + fprintf(out, " * Generated automatically by crc32.c\n */\n\n"); + fprintf(out, "local const z_crc_t FAR "); + fprintf(out, "crc_table[TBLS][256] =\n{\n {\n"); + write_table(out, crc_table[0]); +# ifdef BYFOUR + fprintf(out, "#ifdef BYFOUR\n"); + for (k = 1; k < 8; k++) { + fprintf(out, " },\n {\n"); + write_table(out, crc_table[k]); + } + fprintf(out, "#endif\n"); +# endif /* BYFOUR */ + fprintf(out, " }\n};\n"); + fclose(out); + } +#endif /* MAKECRCH */ +} + +#ifdef MAKECRCH +local void write_table(out, table) + FILE *out; + const z_crc_t FAR *table; +{ + int n; + + for (n = 0; n < 256; n++) + fprintf(out, "%s0x%08lxUL%s", n % 5 ? "" : " ", + (unsigned long)(table[n]), + n == 255 ? "\n" : (n % 5 == 4 ? ",\n" : ", ")); +} +#endif /* MAKECRCH */ + +#else /* !DYNAMIC_CRC_TABLE */ +/* ======================================================================== + * Tables of CRC-32s of all single-byte values, made by make_crc_table(). + */ +#include "crc32.h" +#endif /* DYNAMIC_CRC_TABLE */ + +/* ========================================================================= + * This function can be used by asm versions of crc32() + */ +const z_crc_t FAR * ZEXPORT get_crc_table() +{ +#ifdef DYNAMIC_CRC_TABLE + if (crc_table_empty) + make_crc_table(); +#endif /* DYNAMIC_CRC_TABLE */ + return (const z_crc_t FAR *)crc_table; +} + +/* ========================================================================= */ +#define DO1 crc = crc_table[0][((int)crc ^ (*buf++)) & 0xff] ^ (crc >> 8) +#define DO8 DO1; DO1; DO1; DO1; DO1; DO1; DO1; DO1 + +/* ========================================================================= */ +unsigned long ZEXPORT crc32_z(crc, buf, len) + unsigned long crc; + const unsigned char FAR *buf; + z_size_t len; +{ + if (buf == Z_NULL) return 0UL; + +#ifdef DYNAMIC_CRC_TABLE + if (crc_table_empty) + make_crc_table(); +#endif /* DYNAMIC_CRC_TABLE */ + +#ifdef BYFOUR + if (sizeof(void *) == sizeof(ptrdiff_t)) { + z_crc_t endian; + + endian = 1; + if (*((unsigned char *)(&endian))) + return crc32_little(crc, buf, len); + else + return crc32_big(crc, buf, len); + } +#endif /* BYFOUR */ + crc = crc ^ 0xffffffffUL; + while (len >= 8) { + DO8; + len -= 8; + } + if (len) do { + DO1; + } while (--len); + return crc ^ 0xffffffffUL; +} + +/* ========================================================================= */ +unsigned long ZEXPORT crc32(crc, buf, len) + unsigned long crc; + const unsigned char FAR *buf; + uInt len; +{ + return crc32_z(crc, buf, len); +} + +#ifdef BYFOUR + +/* + This BYFOUR code accesses the passed unsigned char * buffer with a 32-bit + integer pointer type. This violates the strict aliasing rule, where a + compiler can assume, for optimization purposes, that two pointers to + fundamentally different types won't ever point to the same memory. This can + manifest as a problem only if one of the pointers is written to. This code + only reads from those pointers. So long as this code remains isolated in + this compilation unit, there won't be a problem. For this reason, this code + should not be copied and pasted into a compilation unit in which other code + writes to the buffer that is passed to these routines. + */ + +/* ========================================================================= */ +#define DOLIT4 c ^= *buf4++; \ + c = crc_table[3][c & 0xff] ^ crc_table[2][(c >> 8) & 0xff] ^ \ + crc_table[1][(c >> 16) & 0xff] ^ crc_table[0][c >> 24] +#define DOLIT32 DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4; DOLIT4 + +/* ========================================================================= */ +local unsigned long crc32_little(crc, buf, len) + unsigned long crc; + const unsigned char FAR *buf; + z_size_t len; +{ + register z_crc_t c; + register const z_crc_t FAR *buf4; + + c = (z_crc_t)crc; + c = ~c; + while (len && ((ptrdiff_t)buf & 3)) { + c = crc_table[0][(c ^ *buf++) & 0xff] ^ (c >> 8); + len--; + } + + buf4 = (const z_crc_t FAR *)(const void FAR *)buf; + while (len >= 32) { + DOLIT32; + len -= 32; + } + while (len >= 4) { + DOLIT4; + len -= 4; + } + buf = (const unsigned char FAR *)buf4; + + if (len) do { + c = crc_table[0][(c ^ *buf++) & 0xff] ^ (c >> 8); + } while (--len); + c = ~c; + return (unsigned long)c; +} + +/* ========================================================================= */ +#define DOBIG4 c ^= *buf4++; \ + c = crc_table[4][c & 0xff] ^ crc_table[5][(c >> 8) & 0xff] ^ \ + crc_table[6][(c >> 16) & 0xff] ^ crc_table[7][c >> 24] +#define DOBIG32 DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4; DOBIG4 + +/* ========================================================================= */ +local unsigned long crc32_big(crc, buf, len) + unsigned long crc; + const unsigned char FAR *buf; + z_size_t len; +{ + register z_crc_t c; + register const z_crc_t FAR *buf4; + + c = ZSWAP32((z_crc_t)crc); + c = ~c; + while (len && ((ptrdiff_t)buf & 3)) { + c = crc_table[4][(c >> 24) ^ *buf++] ^ (c << 8); + len--; + } + + buf4 = (const z_crc_t FAR *)(const void FAR *)buf; + while (len >= 32) { + DOBIG32; + len -= 32; + } + while (len >= 4) { + DOBIG4; + len -= 4; + } + buf = (const unsigned char FAR *)buf4; + + if (len) do { + c = crc_table[4][(c >> 24) ^ *buf++] ^ (c << 8); + } while (--len); + c = ~c; + return (unsigned long)(ZSWAP32(c)); +} + +#endif /* BYFOUR */ + +#define GF2_DIM 32 /* dimension of GF(2) vectors (length of CRC) */ + +/* ========================================================================= */ +local unsigned long gf2_matrix_times(mat, vec) + unsigned long *mat; + unsigned long vec; +{ + unsigned long sum; + + sum = 0; + while (vec) { + if (vec & 1) + sum ^= *mat; + vec >>= 1; + mat++; + } + return sum; +} + +/* ========================================================================= */ +local void gf2_matrix_square(square, mat) + unsigned long *square; + unsigned long *mat; +{ + int n; + + for (n = 0; n < GF2_DIM; n++) + square[n] = gf2_matrix_times(mat, mat[n]); +} + +/* ========================================================================= */ +local uLong crc32_combine_(crc1, crc2, len2) + uLong crc1; + uLong crc2; + z_off64_t len2; +{ + int n; + unsigned long row; + unsigned long even[GF2_DIM]; /* even-power-of-two zeros operator */ + unsigned long odd[GF2_DIM]; /* odd-power-of-two zeros operator */ + + /* degenerate case (also disallow negative lengths) */ + if (len2 <= 0) + return crc1; + + /* put operator for one zero bit in odd */ + odd[0] = 0xedb88320UL; /* CRC-32 polynomial */ + row = 1; + for (n = 1; n < GF2_DIM; n++) { + odd[n] = row; + row <<= 1; + } + + /* put operator for two zero bits in even */ + gf2_matrix_square(even, odd); + + /* put operator for four zero bits in odd */ + gf2_matrix_square(odd, even); + + /* apply len2 zeros to crc1 (first square will put the operator for one + zero byte, eight zero bits, in even) */ + do { + /* apply zeros operator for this bit of len2 */ + gf2_matrix_square(even, odd); + if (len2 & 1) + crc1 = gf2_matrix_times(even, crc1); + len2 >>= 1; + + /* if no more bits set, then done */ + if (len2 == 0) + break; + + /* another iteration of the loop with odd and even swapped */ + gf2_matrix_square(odd, even); + if (len2 & 1) + crc1 = gf2_matrix_times(odd, crc1); + len2 >>= 1; + + /* if no more bits set, then done */ + } while (len2 != 0); + + /* return combined crc */ + crc1 ^= crc2; + return crc1; +} + +/* ========================================================================= */ +uLong ZEXPORT crc32_combine(crc1, crc2, len2) + uLong crc1; + uLong crc2; + z_off_t len2; +{ + return crc32_combine_(crc1, crc2, (z_off64_t)len2); +} + +uLong ZEXPORT crc32_combine64(crc1, crc2, len2) + uLong crc1; + uLong crc2; + z_off64_t len2; +{ + return crc32_combine_(crc1, crc2, len2); +} diff --git a/PdbChecker/zlib/crc32.h b/PdbChecker/zlib/crc32.h new file mode 100644 index 0000000..9e0c778 --- /dev/null +++ b/PdbChecker/zlib/crc32.h @@ -0,0 +1,441 @@ +/* crc32.h -- tables for rapid CRC calculation + * Generated automatically by crc32.c + */ + +local const z_crc_t FAR crc_table[TBLS][256] = +{ + { + 0x00000000UL, 0x77073096UL, 0xee0e612cUL, 0x990951baUL, 0x076dc419UL, + 0x706af48fUL, 0xe963a535UL, 0x9e6495a3UL, 0x0edb8832UL, 0x79dcb8a4UL, + 0xe0d5e91eUL, 0x97d2d988UL, 0x09b64c2bUL, 0x7eb17cbdUL, 0xe7b82d07UL, + 0x90bf1d91UL, 0x1db71064UL, 0x6ab020f2UL, 0xf3b97148UL, 0x84be41deUL, + 0x1adad47dUL, 0x6ddde4ebUL, 0xf4d4b551UL, 0x83d385c7UL, 0x136c9856UL, + 0x646ba8c0UL, 0xfd62f97aUL, 0x8a65c9ecUL, 0x14015c4fUL, 0x63066cd9UL, + 0xfa0f3d63UL, 0x8d080df5UL, 0x3b6e20c8UL, 0x4c69105eUL, 0xd56041e4UL, + 0xa2677172UL, 0x3c03e4d1UL, 0x4b04d447UL, 0xd20d85fdUL, 0xa50ab56bUL, + 0x35b5a8faUL, 0x42b2986cUL, 0xdbbbc9d6UL, 0xacbcf940UL, 0x32d86ce3UL, + 0x45df5c75UL, 0xdcd60dcfUL, 0xabd13d59UL, 0x26d930acUL, 0x51de003aUL, + 0xc8d75180UL, 0xbfd06116UL, 0x21b4f4b5UL, 0x56b3c423UL, 0xcfba9599UL, + 0xb8bda50fUL, 0x2802b89eUL, 0x5f058808UL, 0xc60cd9b2UL, 0xb10be924UL, + 0x2f6f7c87UL, 0x58684c11UL, 0xc1611dabUL, 0xb6662d3dUL, 0x76dc4190UL, + 0x01db7106UL, 0x98d220bcUL, 0xefd5102aUL, 0x71b18589UL, 0x06b6b51fUL, + 0x9fbfe4a5UL, 0xe8b8d433UL, 0x7807c9a2UL, 0x0f00f934UL, 0x9609a88eUL, + 0xe10e9818UL, 0x7f6a0dbbUL, 0x086d3d2dUL, 0x91646c97UL, 0xe6635c01UL, + 0x6b6b51f4UL, 0x1c6c6162UL, 0x856530d8UL, 0xf262004eUL, 0x6c0695edUL, + 0x1b01a57bUL, 0x8208f4c1UL, 0xf50fc457UL, 0x65b0d9c6UL, 0x12b7e950UL, + 0x8bbeb8eaUL, 0xfcb9887cUL, 0x62dd1ddfUL, 0x15da2d49UL, 0x8cd37cf3UL, + 0xfbd44c65UL, 0x4db26158UL, 0x3ab551ceUL, 0xa3bc0074UL, 0xd4bb30e2UL, + 0x4adfa541UL, 0x3dd895d7UL, 0xa4d1c46dUL, 0xd3d6f4fbUL, 0x4369e96aUL, + 0x346ed9fcUL, 0xad678846UL, 0xda60b8d0UL, 0x44042d73UL, 0x33031de5UL, + 0xaa0a4c5fUL, 0xdd0d7cc9UL, 0x5005713cUL, 0x270241aaUL, 0xbe0b1010UL, + 0xc90c2086UL, 0x5768b525UL, 0x206f85b3UL, 0xb966d409UL, 0xce61e49fUL, + 0x5edef90eUL, 0x29d9c998UL, 0xb0d09822UL, 0xc7d7a8b4UL, 0x59b33d17UL, + 0x2eb40d81UL, 0xb7bd5c3bUL, 0xc0ba6cadUL, 0xedb88320UL, 0x9abfb3b6UL, + 0x03b6e20cUL, 0x74b1d29aUL, 0xead54739UL, 0x9dd277afUL, 0x04db2615UL, + 0x73dc1683UL, 0xe3630b12UL, 0x94643b84UL, 0x0d6d6a3eUL, 0x7a6a5aa8UL, + 0xe40ecf0bUL, 0x9309ff9dUL, 0x0a00ae27UL, 0x7d079eb1UL, 0xf00f9344UL, + 0x8708a3d2UL, 0x1e01f268UL, 0x6906c2feUL, 0xf762575dUL, 0x806567cbUL, + 0x196c3671UL, 0x6e6b06e7UL, 0xfed41b76UL, 0x89d32be0UL, 0x10da7a5aUL, + 0x67dd4accUL, 0xf9b9df6fUL, 0x8ebeeff9UL, 0x17b7be43UL, 0x60b08ed5UL, + 0xd6d6a3e8UL, 0xa1d1937eUL, 0x38d8c2c4UL, 0x4fdff252UL, 0xd1bb67f1UL, + 0xa6bc5767UL, 0x3fb506ddUL, 0x48b2364bUL, 0xd80d2bdaUL, 0xaf0a1b4cUL, + 0x36034af6UL, 0x41047a60UL, 0xdf60efc3UL, 0xa867df55UL, 0x316e8eefUL, + 0x4669be79UL, 0xcb61b38cUL, 0xbc66831aUL, 0x256fd2a0UL, 0x5268e236UL, + 0xcc0c7795UL, 0xbb0b4703UL, 0x220216b9UL, 0x5505262fUL, 0xc5ba3bbeUL, + 0xb2bd0b28UL, 0x2bb45a92UL, 0x5cb36a04UL, 0xc2d7ffa7UL, 0xb5d0cf31UL, + 0x2cd99e8bUL, 0x5bdeae1dUL, 0x9b64c2b0UL, 0xec63f226UL, 0x756aa39cUL, + 0x026d930aUL, 0x9c0906a9UL, 0xeb0e363fUL, 0x72076785UL, 0x05005713UL, + 0x95bf4a82UL, 0xe2b87a14UL, 0x7bb12baeUL, 0x0cb61b38UL, 0x92d28e9bUL, + 0xe5d5be0dUL, 0x7cdcefb7UL, 0x0bdbdf21UL, 0x86d3d2d4UL, 0xf1d4e242UL, + 0x68ddb3f8UL, 0x1fda836eUL, 0x81be16cdUL, 0xf6b9265bUL, 0x6fb077e1UL, + 0x18b74777UL, 0x88085ae6UL, 0xff0f6a70UL, 0x66063bcaUL, 0x11010b5cUL, + 0x8f659effUL, 0xf862ae69UL, 0x616bffd3UL, 0x166ccf45UL, 0xa00ae278UL, + 0xd70dd2eeUL, 0x4e048354UL, 0x3903b3c2UL, 0xa7672661UL, 0xd06016f7UL, + 0x4969474dUL, 0x3e6e77dbUL, 0xaed16a4aUL, 0xd9d65adcUL, 0x40df0b66UL, + 0x37d83bf0UL, 0xa9bcae53UL, 0xdebb9ec5UL, 0x47b2cf7fUL, 0x30b5ffe9UL, + 0xbdbdf21cUL, 0xcabac28aUL, 0x53b39330UL, 0x24b4a3a6UL, 0xbad03605UL, + 0xcdd70693UL, 0x54de5729UL, 0x23d967bfUL, 0xb3667a2eUL, 0xc4614ab8UL, + 0x5d681b02UL, 0x2a6f2b94UL, 0xb40bbe37UL, 0xc30c8ea1UL, 0x5a05df1bUL, + 0x2d02ef8dUL +#ifdef BYFOUR + }, + { + 0x00000000UL, 0x191b3141UL, 0x32366282UL, 0x2b2d53c3UL, 0x646cc504UL, + 0x7d77f445UL, 0x565aa786UL, 0x4f4196c7UL, 0xc8d98a08UL, 0xd1c2bb49UL, + 0xfaefe88aUL, 0xe3f4d9cbUL, 0xacb54f0cUL, 0xb5ae7e4dUL, 0x9e832d8eUL, + 0x87981ccfUL, 0x4ac21251UL, 0x53d92310UL, 0x78f470d3UL, 0x61ef4192UL, + 0x2eaed755UL, 0x37b5e614UL, 0x1c98b5d7UL, 0x05838496UL, 0x821b9859UL, + 0x9b00a918UL, 0xb02dfadbUL, 0xa936cb9aUL, 0xe6775d5dUL, 0xff6c6c1cUL, + 0xd4413fdfUL, 0xcd5a0e9eUL, 0x958424a2UL, 0x8c9f15e3UL, 0xa7b24620UL, + 0xbea97761UL, 0xf1e8e1a6UL, 0xe8f3d0e7UL, 0xc3de8324UL, 0xdac5b265UL, + 0x5d5daeaaUL, 0x44469febUL, 0x6f6bcc28UL, 0x7670fd69UL, 0x39316baeUL, + 0x202a5aefUL, 0x0b07092cUL, 0x121c386dUL, 0xdf4636f3UL, 0xc65d07b2UL, + 0xed705471UL, 0xf46b6530UL, 0xbb2af3f7UL, 0xa231c2b6UL, 0x891c9175UL, + 0x9007a034UL, 0x179fbcfbUL, 0x0e848dbaUL, 0x25a9de79UL, 0x3cb2ef38UL, + 0x73f379ffUL, 0x6ae848beUL, 0x41c51b7dUL, 0x58de2a3cUL, 0xf0794f05UL, + 0xe9627e44UL, 0xc24f2d87UL, 0xdb541cc6UL, 0x94158a01UL, 0x8d0ebb40UL, + 0xa623e883UL, 0xbf38d9c2UL, 0x38a0c50dUL, 0x21bbf44cUL, 0x0a96a78fUL, + 0x138d96ceUL, 0x5ccc0009UL, 0x45d73148UL, 0x6efa628bUL, 0x77e153caUL, + 0xbabb5d54UL, 0xa3a06c15UL, 0x888d3fd6UL, 0x91960e97UL, 0xded79850UL, + 0xc7cca911UL, 0xece1fad2UL, 0xf5facb93UL, 0x7262d75cUL, 0x6b79e61dUL, + 0x4054b5deUL, 0x594f849fUL, 0x160e1258UL, 0x0f152319UL, 0x243870daUL, + 0x3d23419bUL, 0x65fd6ba7UL, 0x7ce65ae6UL, 0x57cb0925UL, 0x4ed03864UL, + 0x0191aea3UL, 0x188a9fe2UL, 0x33a7cc21UL, 0x2abcfd60UL, 0xad24e1afUL, + 0xb43fd0eeUL, 0x9f12832dUL, 0x8609b26cUL, 0xc94824abUL, 0xd05315eaUL, + 0xfb7e4629UL, 0xe2657768UL, 0x2f3f79f6UL, 0x362448b7UL, 0x1d091b74UL, + 0x04122a35UL, 0x4b53bcf2UL, 0x52488db3UL, 0x7965de70UL, 0x607eef31UL, + 0xe7e6f3feUL, 0xfefdc2bfUL, 0xd5d0917cUL, 0xcccba03dUL, 0x838a36faUL, + 0x9a9107bbUL, 0xb1bc5478UL, 0xa8a76539UL, 0x3b83984bUL, 0x2298a90aUL, + 0x09b5fac9UL, 0x10aecb88UL, 0x5fef5d4fUL, 0x46f46c0eUL, 0x6dd93fcdUL, + 0x74c20e8cUL, 0xf35a1243UL, 0xea412302UL, 0xc16c70c1UL, 0xd8774180UL, + 0x9736d747UL, 0x8e2de606UL, 0xa500b5c5UL, 0xbc1b8484UL, 0x71418a1aUL, + 0x685abb5bUL, 0x4377e898UL, 0x5a6cd9d9UL, 0x152d4f1eUL, 0x0c367e5fUL, + 0x271b2d9cUL, 0x3e001cddUL, 0xb9980012UL, 0xa0833153UL, 0x8bae6290UL, + 0x92b553d1UL, 0xddf4c516UL, 0xc4eff457UL, 0xefc2a794UL, 0xf6d996d5UL, + 0xae07bce9UL, 0xb71c8da8UL, 0x9c31de6bUL, 0x852aef2aUL, 0xca6b79edUL, + 0xd37048acUL, 0xf85d1b6fUL, 0xe1462a2eUL, 0x66de36e1UL, 0x7fc507a0UL, + 0x54e85463UL, 0x4df36522UL, 0x02b2f3e5UL, 0x1ba9c2a4UL, 0x30849167UL, + 0x299fa026UL, 0xe4c5aeb8UL, 0xfdde9ff9UL, 0xd6f3cc3aUL, 0xcfe8fd7bUL, + 0x80a96bbcUL, 0x99b25afdUL, 0xb29f093eUL, 0xab84387fUL, 0x2c1c24b0UL, + 0x350715f1UL, 0x1e2a4632UL, 0x07317773UL, 0x4870e1b4UL, 0x516bd0f5UL, + 0x7a468336UL, 0x635db277UL, 0xcbfad74eUL, 0xd2e1e60fUL, 0xf9ccb5ccUL, + 0xe0d7848dUL, 0xaf96124aUL, 0xb68d230bUL, 0x9da070c8UL, 0x84bb4189UL, + 0x03235d46UL, 0x1a386c07UL, 0x31153fc4UL, 0x280e0e85UL, 0x674f9842UL, + 0x7e54a903UL, 0x5579fac0UL, 0x4c62cb81UL, 0x8138c51fUL, 0x9823f45eUL, + 0xb30ea79dUL, 0xaa1596dcUL, 0xe554001bUL, 0xfc4f315aUL, 0xd7626299UL, + 0xce7953d8UL, 0x49e14f17UL, 0x50fa7e56UL, 0x7bd72d95UL, 0x62cc1cd4UL, + 0x2d8d8a13UL, 0x3496bb52UL, 0x1fbbe891UL, 0x06a0d9d0UL, 0x5e7ef3ecUL, + 0x4765c2adUL, 0x6c48916eUL, 0x7553a02fUL, 0x3a1236e8UL, 0x230907a9UL, + 0x0824546aUL, 0x113f652bUL, 0x96a779e4UL, 0x8fbc48a5UL, 0xa4911b66UL, + 0xbd8a2a27UL, 0xf2cbbce0UL, 0xebd08da1UL, 0xc0fdde62UL, 0xd9e6ef23UL, + 0x14bce1bdUL, 0x0da7d0fcUL, 0x268a833fUL, 0x3f91b27eUL, 0x70d024b9UL, + 0x69cb15f8UL, 0x42e6463bUL, 0x5bfd777aUL, 0xdc656bb5UL, 0xc57e5af4UL, + 0xee530937UL, 0xf7483876UL, 0xb809aeb1UL, 0xa1129ff0UL, 0x8a3fcc33UL, + 0x9324fd72UL + }, + { + 0x00000000UL, 0x01c26a37UL, 0x0384d46eUL, 0x0246be59UL, 0x0709a8dcUL, + 0x06cbc2ebUL, 0x048d7cb2UL, 0x054f1685UL, 0x0e1351b8UL, 0x0fd13b8fUL, + 0x0d9785d6UL, 0x0c55efe1UL, 0x091af964UL, 0x08d89353UL, 0x0a9e2d0aUL, + 0x0b5c473dUL, 0x1c26a370UL, 0x1de4c947UL, 0x1fa2771eUL, 0x1e601d29UL, + 0x1b2f0bacUL, 0x1aed619bUL, 0x18abdfc2UL, 0x1969b5f5UL, 0x1235f2c8UL, + 0x13f798ffUL, 0x11b126a6UL, 0x10734c91UL, 0x153c5a14UL, 0x14fe3023UL, + 0x16b88e7aUL, 0x177ae44dUL, 0x384d46e0UL, 0x398f2cd7UL, 0x3bc9928eUL, + 0x3a0bf8b9UL, 0x3f44ee3cUL, 0x3e86840bUL, 0x3cc03a52UL, 0x3d025065UL, + 0x365e1758UL, 0x379c7d6fUL, 0x35dac336UL, 0x3418a901UL, 0x3157bf84UL, + 0x3095d5b3UL, 0x32d36beaUL, 0x331101ddUL, 0x246be590UL, 0x25a98fa7UL, + 0x27ef31feUL, 0x262d5bc9UL, 0x23624d4cUL, 0x22a0277bUL, 0x20e69922UL, + 0x2124f315UL, 0x2a78b428UL, 0x2bbade1fUL, 0x29fc6046UL, 0x283e0a71UL, + 0x2d711cf4UL, 0x2cb376c3UL, 0x2ef5c89aUL, 0x2f37a2adUL, 0x709a8dc0UL, + 0x7158e7f7UL, 0x731e59aeUL, 0x72dc3399UL, 0x7793251cUL, 0x76514f2bUL, + 0x7417f172UL, 0x75d59b45UL, 0x7e89dc78UL, 0x7f4bb64fUL, 0x7d0d0816UL, + 0x7ccf6221UL, 0x798074a4UL, 0x78421e93UL, 0x7a04a0caUL, 0x7bc6cafdUL, + 0x6cbc2eb0UL, 0x6d7e4487UL, 0x6f38fadeUL, 0x6efa90e9UL, 0x6bb5866cUL, + 0x6a77ec5bUL, 0x68315202UL, 0x69f33835UL, 0x62af7f08UL, 0x636d153fUL, + 0x612bab66UL, 0x60e9c151UL, 0x65a6d7d4UL, 0x6464bde3UL, 0x662203baUL, + 0x67e0698dUL, 0x48d7cb20UL, 0x4915a117UL, 0x4b531f4eUL, 0x4a917579UL, + 0x4fde63fcUL, 0x4e1c09cbUL, 0x4c5ab792UL, 0x4d98dda5UL, 0x46c49a98UL, + 0x4706f0afUL, 0x45404ef6UL, 0x448224c1UL, 0x41cd3244UL, 0x400f5873UL, + 0x4249e62aUL, 0x438b8c1dUL, 0x54f16850UL, 0x55330267UL, 0x5775bc3eUL, + 0x56b7d609UL, 0x53f8c08cUL, 0x523aaabbUL, 0x507c14e2UL, 0x51be7ed5UL, + 0x5ae239e8UL, 0x5b2053dfUL, 0x5966ed86UL, 0x58a487b1UL, 0x5deb9134UL, + 0x5c29fb03UL, 0x5e6f455aUL, 0x5fad2f6dUL, 0xe1351b80UL, 0xe0f771b7UL, + 0xe2b1cfeeUL, 0xe373a5d9UL, 0xe63cb35cUL, 0xe7fed96bUL, 0xe5b86732UL, + 0xe47a0d05UL, 0xef264a38UL, 0xeee4200fUL, 0xeca29e56UL, 0xed60f461UL, + 0xe82fe2e4UL, 0xe9ed88d3UL, 0xebab368aUL, 0xea695cbdUL, 0xfd13b8f0UL, + 0xfcd1d2c7UL, 0xfe976c9eUL, 0xff5506a9UL, 0xfa1a102cUL, 0xfbd87a1bUL, + 0xf99ec442UL, 0xf85cae75UL, 0xf300e948UL, 0xf2c2837fUL, 0xf0843d26UL, + 0xf1465711UL, 0xf4094194UL, 0xf5cb2ba3UL, 0xf78d95faUL, 0xf64fffcdUL, + 0xd9785d60UL, 0xd8ba3757UL, 0xdafc890eUL, 0xdb3ee339UL, 0xde71f5bcUL, + 0xdfb39f8bUL, 0xddf521d2UL, 0xdc374be5UL, 0xd76b0cd8UL, 0xd6a966efUL, + 0xd4efd8b6UL, 0xd52db281UL, 0xd062a404UL, 0xd1a0ce33UL, 0xd3e6706aUL, + 0xd2241a5dUL, 0xc55efe10UL, 0xc49c9427UL, 0xc6da2a7eUL, 0xc7184049UL, + 0xc25756ccUL, 0xc3953cfbUL, 0xc1d382a2UL, 0xc011e895UL, 0xcb4dafa8UL, + 0xca8fc59fUL, 0xc8c97bc6UL, 0xc90b11f1UL, 0xcc440774UL, 0xcd866d43UL, + 0xcfc0d31aUL, 0xce02b92dUL, 0x91af9640UL, 0x906dfc77UL, 0x922b422eUL, + 0x93e92819UL, 0x96a63e9cUL, 0x976454abUL, 0x9522eaf2UL, 0x94e080c5UL, + 0x9fbcc7f8UL, 0x9e7eadcfUL, 0x9c381396UL, 0x9dfa79a1UL, 0x98b56f24UL, + 0x99770513UL, 0x9b31bb4aUL, 0x9af3d17dUL, 0x8d893530UL, 0x8c4b5f07UL, + 0x8e0de15eUL, 0x8fcf8b69UL, 0x8a809decUL, 0x8b42f7dbUL, 0x89044982UL, + 0x88c623b5UL, 0x839a6488UL, 0x82580ebfUL, 0x801eb0e6UL, 0x81dcdad1UL, + 0x8493cc54UL, 0x8551a663UL, 0x8717183aUL, 0x86d5720dUL, 0xa9e2d0a0UL, + 0xa820ba97UL, 0xaa6604ceUL, 0xaba46ef9UL, 0xaeeb787cUL, 0xaf29124bUL, + 0xad6fac12UL, 0xacadc625UL, 0xa7f18118UL, 0xa633eb2fUL, 0xa4755576UL, + 0xa5b73f41UL, 0xa0f829c4UL, 0xa13a43f3UL, 0xa37cfdaaUL, 0xa2be979dUL, + 0xb5c473d0UL, 0xb40619e7UL, 0xb640a7beUL, 0xb782cd89UL, 0xb2cddb0cUL, + 0xb30fb13bUL, 0xb1490f62UL, 0xb08b6555UL, 0xbbd72268UL, 0xba15485fUL, + 0xb853f606UL, 0xb9919c31UL, 0xbcde8ab4UL, 0xbd1ce083UL, 0xbf5a5edaUL, + 0xbe9834edUL + }, + { + 0x00000000UL, 0xb8bc6765UL, 0xaa09c88bUL, 0x12b5afeeUL, 0x8f629757UL, + 0x37def032UL, 0x256b5fdcUL, 0x9dd738b9UL, 0xc5b428efUL, 0x7d084f8aUL, + 0x6fbde064UL, 0xd7018701UL, 0x4ad6bfb8UL, 0xf26ad8ddUL, 0xe0df7733UL, + 0x58631056UL, 0x5019579fUL, 0xe8a530faUL, 0xfa109f14UL, 0x42acf871UL, + 0xdf7bc0c8UL, 0x67c7a7adUL, 0x75720843UL, 0xcdce6f26UL, 0x95ad7f70UL, + 0x2d111815UL, 0x3fa4b7fbUL, 0x8718d09eUL, 0x1acfe827UL, 0xa2738f42UL, + 0xb0c620acUL, 0x087a47c9UL, 0xa032af3eUL, 0x188ec85bUL, 0x0a3b67b5UL, + 0xb28700d0UL, 0x2f503869UL, 0x97ec5f0cUL, 0x8559f0e2UL, 0x3de59787UL, + 0x658687d1UL, 0xdd3ae0b4UL, 0xcf8f4f5aUL, 0x7733283fUL, 0xeae41086UL, + 0x525877e3UL, 0x40edd80dUL, 0xf851bf68UL, 0xf02bf8a1UL, 0x48979fc4UL, + 0x5a22302aUL, 0xe29e574fUL, 0x7f496ff6UL, 0xc7f50893UL, 0xd540a77dUL, + 0x6dfcc018UL, 0x359fd04eUL, 0x8d23b72bUL, 0x9f9618c5UL, 0x272a7fa0UL, + 0xbafd4719UL, 0x0241207cUL, 0x10f48f92UL, 0xa848e8f7UL, 0x9b14583dUL, + 0x23a83f58UL, 0x311d90b6UL, 0x89a1f7d3UL, 0x1476cf6aUL, 0xaccaa80fUL, + 0xbe7f07e1UL, 0x06c36084UL, 0x5ea070d2UL, 0xe61c17b7UL, 0xf4a9b859UL, + 0x4c15df3cUL, 0xd1c2e785UL, 0x697e80e0UL, 0x7bcb2f0eUL, 0xc377486bUL, + 0xcb0d0fa2UL, 0x73b168c7UL, 0x6104c729UL, 0xd9b8a04cUL, 0x446f98f5UL, + 0xfcd3ff90UL, 0xee66507eUL, 0x56da371bUL, 0x0eb9274dUL, 0xb6054028UL, + 0xa4b0efc6UL, 0x1c0c88a3UL, 0x81dbb01aUL, 0x3967d77fUL, 0x2bd27891UL, + 0x936e1ff4UL, 0x3b26f703UL, 0x839a9066UL, 0x912f3f88UL, 0x299358edUL, + 0xb4446054UL, 0x0cf80731UL, 0x1e4da8dfUL, 0xa6f1cfbaUL, 0xfe92dfecUL, + 0x462eb889UL, 0x549b1767UL, 0xec277002UL, 0x71f048bbUL, 0xc94c2fdeUL, + 0xdbf98030UL, 0x6345e755UL, 0x6b3fa09cUL, 0xd383c7f9UL, 0xc1366817UL, + 0x798a0f72UL, 0xe45d37cbUL, 0x5ce150aeUL, 0x4e54ff40UL, 0xf6e89825UL, + 0xae8b8873UL, 0x1637ef16UL, 0x048240f8UL, 0xbc3e279dUL, 0x21e91f24UL, + 0x99557841UL, 0x8be0d7afUL, 0x335cb0caUL, 0xed59b63bUL, 0x55e5d15eUL, + 0x47507eb0UL, 0xffec19d5UL, 0x623b216cUL, 0xda874609UL, 0xc832e9e7UL, + 0x708e8e82UL, 0x28ed9ed4UL, 0x9051f9b1UL, 0x82e4565fUL, 0x3a58313aUL, + 0xa78f0983UL, 0x1f336ee6UL, 0x0d86c108UL, 0xb53aa66dUL, 0xbd40e1a4UL, + 0x05fc86c1UL, 0x1749292fUL, 0xaff54e4aUL, 0x322276f3UL, 0x8a9e1196UL, + 0x982bbe78UL, 0x2097d91dUL, 0x78f4c94bUL, 0xc048ae2eUL, 0xd2fd01c0UL, + 0x6a4166a5UL, 0xf7965e1cUL, 0x4f2a3979UL, 0x5d9f9697UL, 0xe523f1f2UL, + 0x4d6b1905UL, 0xf5d77e60UL, 0xe762d18eUL, 0x5fdeb6ebUL, 0xc2098e52UL, + 0x7ab5e937UL, 0x680046d9UL, 0xd0bc21bcUL, 0x88df31eaUL, 0x3063568fUL, + 0x22d6f961UL, 0x9a6a9e04UL, 0x07bda6bdUL, 0xbf01c1d8UL, 0xadb46e36UL, + 0x15080953UL, 0x1d724e9aUL, 0xa5ce29ffUL, 0xb77b8611UL, 0x0fc7e174UL, + 0x9210d9cdUL, 0x2aacbea8UL, 0x38191146UL, 0x80a57623UL, 0xd8c66675UL, + 0x607a0110UL, 0x72cfaefeUL, 0xca73c99bUL, 0x57a4f122UL, 0xef189647UL, + 0xfdad39a9UL, 0x45115eccUL, 0x764dee06UL, 0xcef18963UL, 0xdc44268dUL, + 0x64f841e8UL, 0xf92f7951UL, 0x41931e34UL, 0x5326b1daUL, 0xeb9ad6bfUL, + 0xb3f9c6e9UL, 0x0b45a18cUL, 0x19f00e62UL, 0xa14c6907UL, 0x3c9b51beUL, + 0x842736dbUL, 0x96929935UL, 0x2e2efe50UL, 0x2654b999UL, 0x9ee8defcUL, + 0x8c5d7112UL, 0x34e11677UL, 0xa9362eceUL, 0x118a49abUL, 0x033fe645UL, + 0xbb838120UL, 0xe3e09176UL, 0x5b5cf613UL, 0x49e959fdUL, 0xf1553e98UL, + 0x6c820621UL, 0xd43e6144UL, 0xc68bceaaUL, 0x7e37a9cfUL, 0xd67f4138UL, + 0x6ec3265dUL, 0x7c7689b3UL, 0xc4caeed6UL, 0x591dd66fUL, 0xe1a1b10aUL, + 0xf3141ee4UL, 0x4ba87981UL, 0x13cb69d7UL, 0xab770eb2UL, 0xb9c2a15cUL, + 0x017ec639UL, 0x9ca9fe80UL, 0x241599e5UL, 0x36a0360bUL, 0x8e1c516eUL, + 0x866616a7UL, 0x3eda71c2UL, 0x2c6fde2cUL, 0x94d3b949UL, 0x090481f0UL, + 0xb1b8e695UL, 0xa30d497bUL, 0x1bb12e1eUL, 0x43d23e48UL, 0xfb6e592dUL, + 0xe9dbf6c3UL, 0x516791a6UL, 0xccb0a91fUL, 0x740cce7aUL, 0x66b96194UL, + 0xde0506f1UL + }, + { + 0x00000000UL, 0x96300777UL, 0x2c610eeeUL, 0xba510999UL, 0x19c46d07UL, + 0x8ff46a70UL, 0x35a563e9UL, 0xa395649eUL, 0x3288db0eUL, 0xa4b8dc79UL, + 0x1ee9d5e0UL, 0x88d9d297UL, 0x2b4cb609UL, 0xbd7cb17eUL, 0x072db8e7UL, + 0x911dbf90UL, 0x6410b71dUL, 0xf220b06aUL, 0x4871b9f3UL, 0xde41be84UL, + 0x7dd4da1aUL, 0xebe4dd6dUL, 0x51b5d4f4UL, 0xc785d383UL, 0x56986c13UL, + 0xc0a86b64UL, 0x7af962fdUL, 0xecc9658aUL, 0x4f5c0114UL, 0xd96c0663UL, + 0x633d0ffaUL, 0xf50d088dUL, 0xc8206e3bUL, 0x5e10694cUL, 0xe44160d5UL, + 0x727167a2UL, 0xd1e4033cUL, 0x47d4044bUL, 0xfd850dd2UL, 0x6bb50aa5UL, + 0xfaa8b535UL, 0x6c98b242UL, 0xd6c9bbdbUL, 0x40f9bcacUL, 0xe36cd832UL, + 0x755cdf45UL, 0xcf0dd6dcUL, 0x593dd1abUL, 0xac30d926UL, 0x3a00de51UL, + 0x8051d7c8UL, 0x1661d0bfUL, 0xb5f4b421UL, 0x23c4b356UL, 0x9995bacfUL, + 0x0fa5bdb8UL, 0x9eb80228UL, 0x0888055fUL, 0xb2d90cc6UL, 0x24e90bb1UL, + 0x877c6f2fUL, 0x114c6858UL, 0xab1d61c1UL, 0x3d2d66b6UL, 0x9041dc76UL, + 0x0671db01UL, 0xbc20d298UL, 0x2a10d5efUL, 0x8985b171UL, 0x1fb5b606UL, + 0xa5e4bf9fUL, 0x33d4b8e8UL, 0xa2c90778UL, 0x34f9000fUL, 0x8ea80996UL, + 0x18980ee1UL, 0xbb0d6a7fUL, 0x2d3d6d08UL, 0x976c6491UL, 0x015c63e6UL, + 0xf4516b6bUL, 0x62616c1cUL, 0xd8306585UL, 0x4e0062f2UL, 0xed95066cUL, + 0x7ba5011bUL, 0xc1f40882UL, 0x57c40ff5UL, 0xc6d9b065UL, 0x50e9b712UL, + 0xeab8be8bUL, 0x7c88b9fcUL, 0xdf1ddd62UL, 0x492dda15UL, 0xf37cd38cUL, + 0x654cd4fbUL, 0x5861b24dUL, 0xce51b53aUL, 0x7400bca3UL, 0xe230bbd4UL, + 0x41a5df4aUL, 0xd795d83dUL, 0x6dc4d1a4UL, 0xfbf4d6d3UL, 0x6ae96943UL, + 0xfcd96e34UL, 0x468867adUL, 0xd0b860daUL, 0x732d0444UL, 0xe51d0333UL, + 0x5f4c0aaaUL, 0xc97c0dddUL, 0x3c710550UL, 0xaa410227UL, 0x10100bbeUL, + 0x86200cc9UL, 0x25b56857UL, 0xb3856f20UL, 0x09d466b9UL, 0x9fe461ceUL, + 0x0ef9de5eUL, 0x98c9d929UL, 0x2298d0b0UL, 0xb4a8d7c7UL, 0x173db359UL, + 0x810db42eUL, 0x3b5cbdb7UL, 0xad6cbac0UL, 0x2083b8edUL, 0xb6b3bf9aUL, + 0x0ce2b603UL, 0x9ad2b174UL, 0x3947d5eaUL, 0xaf77d29dUL, 0x1526db04UL, + 0x8316dc73UL, 0x120b63e3UL, 0x843b6494UL, 0x3e6a6d0dUL, 0xa85a6a7aUL, + 0x0bcf0ee4UL, 0x9dff0993UL, 0x27ae000aUL, 0xb19e077dUL, 0x44930ff0UL, + 0xd2a30887UL, 0x68f2011eUL, 0xfec20669UL, 0x5d5762f7UL, 0xcb676580UL, + 0x71366c19UL, 0xe7066b6eUL, 0x761bd4feUL, 0xe02bd389UL, 0x5a7ada10UL, + 0xcc4add67UL, 0x6fdfb9f9UL, 0xf9efbe8eUL, 0x43beb717UL, 0xd58eb060UL, + 0xe8a3d6d6UL, 0x7e93d1a1UL, 0xc4c2d838UL, 0x52f2df4fUL, 0xf167bbd1UL, + 0x6757bca6UL, 0xdd06b53fUL, 0x4b36b248UL, 0xda2b0dd8UL, 0x4c1b0aafUL, + 0xf64a0336UL, 0x607a0441UL, 0xc3ef60dfUL, 0x55df67a8UL, 0xef8e6e31UL, + 0x79be6946UL, 0x8cb361cbUL, 0x1a8366bcUL, 0xa0d26f25UL, 0x36e26852UL, + 0x95770cccUL, 0x03470bbbUL, 0xb9160222UL, 0x2f260555UL, 0xbe3bbac5UL, + 0x280bbdb2UL, 0x925ab42bUL, 0x046ab35cUL, 0xa7ffd7c2UL, 0x31cfd0b5UL, + 0x8b9ed92cUL, 0x1daede5bUL, 0xb0c2649bUL, 0x26f263ecUL, 0x9ca36a75UL, + 0x0a936d02UL, 0xa906099cUL, 0x3f360eebUL, 0x85670772UL, 0x13570005UL, + 0x824abf95UL, 0x147ab8e2UL, 0xae2bb17bUL, 0x381bb60cUL, 0x9b8ed292UL, + 0x0dbed5e5UL, 0xb7efdc7cUL, 0x21dfdb0bUL, 0xd4d2d386UL, 0x42e2d4f1UL, + 0xf8b3dd68UL, 0x6e83da1fUL, 0xcd16be81UL, 0x5b26b9f6UL, 0xe177b06fUL, + 0x7747b718UL, 0xe65a0888UL, 0x706a0fffUL, 0xca3b0666UL, 0x5c0b0111UL, + 0xff9e658fUL, 0x69ae62f8UL, 0xd3ff6b61UL, 0x45cf6c16UL, 0x78e20aa0UL, + 0xeed20dd7UL, 0x5483044eUL, 0xc2b30339UL, 0x612667a7UL, 0xf71660d0UL, + 0x4d476949UL, 0xdb776e3eUL, 0x4a6ad1aeUL, 0xdc5ad6d9UL, 0x660bdf40UL, + 0xf03bd837UL, 0x53aebca9UL, 0xc59ebbdeUL, 0x7fcfb247UL, 0xe9ffb530UL, + 0x1cf2bdbdUL, 0x8ac2bacaUL, 0x3093b353UL, 0xa6a3b424UL, 0x0536d0baUL, + 0x9306d7cdUL, 0x2957de54UL, 0xbf67d923UL, 0x2e7a66b3UL, 0xb84a61c4UL, + 0x021b685dUL, 0x942b6f2aUL, 0x37be0bb4UL, 0xa18e0cc3UL, 0x1bdf055aUL, + 0x8def022dUL + }, + { + 0x00000000UL, 0x41311b19UL, 0x82623632UL, 0xc3532d2bUL, 0x04c56c64UL, + 0x45f4777dUL, 0x86a75a56UL, 0xc796414fUL, 0x088ad9c8UL, 0x49bbc2d1UL, + 0x8ae8effaUL, 0xcbd9f4e3UL, 0x0c4fb5acUL, 0x4d7eaeb5UL, 0x8e2d839eUL, + 0xcf1c9887UL, 0x5112c24aUL, 0x1023d953UL, 0xd370f478UL, 0x9241ef61UL, + 0x55d7ae2eUL, 0x14e6b537UL, 0xd7b5981cUL, 0x96848305UL, 0x59981b82UL, + 0x18a9009bUL, 0xdbfa2db0UL, 0x9acb36a9UL, 0x5d5d77e6UL, 0x1c6c6cffUL, + 0xdf3f41d4UL, 0x9e0e5acdUL, 0xa2248495UL, 0xe3159f8cUL, 0x2046b2a7UL, + 0x6177a9beUL, 0xa6e1e8f1UL, 0xe7d0f3e8UL, 0x2483dec3UL, 0x65b2c5daUL, + 0xaaae5d5dUL, 0xeb9f4644UL, 0x28cc6b6fUL, 0x69fd7076UL, 0xae6b3139UL, + 0xef5a2a20UL, 0x2c09070bUL, 0x6d381c12UL, 0xf33646dfUL, 0xb2075dc6UL, + 0x715470edUL, 0x30656bf4UL, 0xf7f32abbUL, 0xb6c231a2UL, 0x75911c89UL, + 0x34a00790UL, 0xfbbc9f17UL, 0xba8d840eUL, 0x79dea925UL, 0x38efb23cUL, + 0xff79f373UL, 0xbe48e86aUL, 0x7d1bc541UL, 0x3c2ade58UL, 0x054f79f0UL, + 0x447e62e9UL, 0x872d4fc2UL, 0xc61c54dbUL, 0x018a1594UL, 0x40bb0e8dUL, + 0x83e823a6UL, 0xc2d938bfUL, 0x0dc5a038UL, 0x4cf4bb21UL, 0x8fa7960aUL, + 0xce968d13UL, 0x0900cc5cUL, 0x4831d745UL, 0x8b62fa6eUL, 0xca53e177UL, + 0x545dbbbaUL, 0x156ca0a3UL, 0xd63f8d88UL, 0x970e9691UL, 0x5098d7deUL, + 0x11a9ccc7UL, 0xd2fae1ecUL, 0x93cbfaf5UL, 0x5cd76272UL, 0x1de6796bUL, + 0xdeb55440UL, 0x9f844f59UL, 0x58120e16UL, 0x1923150fUL, 0xda703824UL, + 0x9b41233dUL, 0xa76bfd65UL, 0xe65ae67cUL, 0x2509cb57UL, 0x6438d04eUL, + 0xa3ae9101UL, 0xe29f8a18UL, 0x21cca733UL, 0x60fdbc2aUL, 0xafe124adUL, + 0xeed03fb4UL, 0x2d83129fUL, 0x6cb20986UL, 0xab2448c9UL, 0xea1553d0UL, + 0x29467efbUL, 0x687765e2UL, 0xf6793f2fUL, 0xb7482436UL, 0x741b091dUL, + 0x352a1204UL, 0xf2bc534bUL, 0xb38d4852UL, 0x70de6579UL, 0x31ef7e60UL, + 0xfef3e6e7UL, 0xbfc2fdfeUL, 0x7c91d0d5UL, 0x3da0cbccUL, 0xfa368a83UL, + 0xbb07919aUL, 0x7854bcb1UL, 0x3965a7a8UL, 0x4b98833bUL, 0x0aa99822UL, + 0xc9fab509UL, 0x88cbae10UL, 0x4f5def5fUL, 0x0e6cf446UL, 0xcd3fd96dUL, + 0x8c0ec274UL, 0x43125af3UL, 0x022341eaUL, 0xc1706cc1UL, 0x804177d8UL, + 0x47d73697UL, 0x06e62d8eUL, 0xc5b500a5UL, 0x84841bbcUL, 0x1a8a4171UL, + 0x5bbb5a68UL, 0x98e87743UL, 0xd9d96c5aUL, 0x1e4f2d15UL, 0x5f7e360cUL, + 0x9c2d1b27UL, 0xdd1c003eUL, 0x120098b9UL, 0x533183a0UL, 0x9062ae8bUL, + 0xd153b592UL, 0x16c5f4ddUL, 0x57f4efc4UL, 0x94a7c2efUL, 0xd596d9f6UL, + 0xe9bc07aeUL, 0xa88d1cb7UL, 0x6bde319cUL, 0x2aef2a85UL, 0xed796bcaUL, + 0xac4870d3UL, 0x6f1b5df8UL, 0x2e2a46e1UL, 0xe136de66UL, 0xa007c57fUL, + 0x6354e854UL, 0x2265f34dUL, 0xe5f3b202UL, 0xa4c2a91bUL, 0x67918430UL, + 0x26a09f29UL, 0xb8aec5e4UL, 0xf99fdefdUL, 0x3accf3d6UL, 0x7bfde8cfUL, + 0xbc6ba980UL, 0xfd5ab299UL, 0x3e099fb2UL, 0x7f3884abUL, 0xb0241c2cUL, + 0xf1150735UL, 0x32462a1eUL, 0x73773107UL, 0xb4e17048UL, 0xf5d06b51UL, + 0x3683467aUL, 0x77b25d63UL, 0x4ed7facbUL, 0x0fe6e1d2UL, 0xccb5ccf9UL, + 0x8d84d7e0UL, 0x4a1296afUL, 0x0b238db6UL, 0xc870a09dUL, 0x8941bb84UL, + 0x465d2303UL, 0x076c381aUL, 0xc43f1531UL, 0x850e0e28UL, 0x42984f67UL, + 0x03a9547eUL, 0xc0fa7955UL, 0x81cb624cUL, 0x1fc53881UL, 0x5ef42398UL, + 0x9da70eb3UL, 0xdc9615aaUL, 0x1b0054e5UL, 0x5a314ffcUL, 0x996262d7UL, + 0xd85379ceUL, 0x174fe149UL, 0x567efa50UL, 0x952dd77bUL, 0xd41ccc62UL, + 0x138a8d2dUL, 0x52bb9634UL, 0x91e8bb1fUL, 0xd0d9a006UL, 0xecf37e5eUL, + 0xadc26547UL, 0x6e91486cUL, 0x2fa05375UL, 0xe836123aUL, 0xa9070923UL, + 0x6a542408UL, 0x2b653f11UL, 0xe479a796UL, 0xa548bc8fUL, 0x661b91a4UL, + 0x272a8abdUL, 0xe0bccbf2UL, 0xa18dd0ebUL, 0x62defdc0UL, 0x23efe6d9UL, + 0xbde1bc14UL, 0xfcd0a70dUL, 0x3f838a26UL, 0x7eb2913fUL, 0xb924d070UL, + 0xf815cb69UL, 0x3b46e642UL, 0x7a77fd5bUL, 0xb56b65dcUL, 0xf45a7ec5UL, + 0x370953eeUL, 0x763848f7UL, 0xb1ae09b8UL, 0xf09f12a1UL, 0x33cc3f8aUL, + 0x72fd2493UL + }, + { + 0x00000000UL, 0x376ac201UL, 0x6ed48403UL, 0x59be4602UL, 0xdca80907UL, + 0xebc2cb06UL, 0xb27c8d04UL, 0x85164f05UL, 0xb851130eUL, 0x8f3bd10fUL, + 0xd685970dUL, 0xe1ef550cUL, 0x64f91a09UL, 0x5393d808UL, 0x0a2d9e0aUL, + 0x3d475c0bUL, 0x70a3261cUL, 0x47c9e41dUL, 0x1e77a21fUL, 0x291d601eUL, + 0xac0b2f1bUL, 0x9b61ed1aUL, 0xc2dfab18UL, 0xf5b56919UL, 0xc8f23512UL, + 0xff98f713UL, 0xa626b111UL, 0x914c7310UL, 0x145a3c15UL, 0x2330fe14UL, + 0x7a8eb816UL, 0x4de47a17UL, 0xe0464d38UL, 0xd72c8f39UL, 0x8e92c93bUL, + 0xb9f80b3aUL, 0x3cee443fUL, 0x0b84863eUL, 0x523ac03cUL, 0x6550023dUL, + 0x58175e36UL, 0x6f7d9c37UL, 0x36c3da35UL, 0x01a91834UL, 0x84bf5731UL, + 0xb3d59530UL, 0xea6bd332UL, 0xdd011133UL, 0x90e56b24UL, 0xa78fa925UL, + 0xfe31ef27UL, 0xc95b2d26UL, 0x4c4d6223UL, 0x7b27a022UL, 0x2299e620UL, + 0x15f32421UL, 0x28b4782aUL, 0x1fdeba2bUL, 0x4660fc29UL, 0x710a3e28UL, + 0xf41c712dUL, 0xc376b32cUL, 0x9ac8f52eUL, 0xada2372fUL, 0xc08d9a70UL, + 0xf7e75871UL, 0xae591e73UL, 0x9933dc72UL, 0x1c259377UL, 0x2b4f5176UL, + 0x72f11774UL, 0x459bd575UL, 0x78dc897eUL, 0x4fb64b7fUL, 0x16080d7dUL, + 0x2162cf7cUL, 0xa4748079UL, 0x931e4278UL, 0xcaa0047aUL, 0xfdcac67bUL, + 0xb02ebc6cUL, 0x87447e6dUL, 0xdefa386fUL, 0xe990fa6eUL, 0x6c86b56bUL, + 0x5bec776aUL, 0x02523168UL, 0x3538f369UL, 0x087faf62UL, 0x3f156d63UL, + 0x66ab2b61UL, 0x51c1e960UL, 0xd4d7a665UL, 0xe3bd6464UL, 0xba032266UL, + 0x8d69e067UL, 0x20cbd748UL, 0x17a11549UL, 0x4e1f534bUL, 0x7975914aUL, + 0xfc63de4fUL, 0xcb091c4eUL, 0x92b75a4cUL, 0xa5dd984dUL, 0x989ac446UL, + 0xaff00647UL, 0xf64e4045UL, 0xc1248244UL, 0x4432cd41UL, 0x73580f40UL, + 0x2ae64942UL, 0x1d8c8b43UL, 0x5068f154UL, 0x67023355UL, 0x3ebc7557UL, + 0x09d6b756UL, 0x8cc0f853UL, 0xbbaa3a52UL, 0xe2147c50UL, 0xd57ebe51UL, + 0xe839e25aUL, 0xdf53205bUL, 0x86ed6659UL, 0xb187a458UL, 0x3491eb5dUL, + 0x03fb295cUL, 0x5a456f5eUL, 0x6d2fad5fUL, 0x801b35e1UL, 0xb771f7e0UL, + 0xeecfb1e2UL, 0xd9a573e3UL, 0x5cb33ce6UL, 0x6bd9fee7UL, 0x3267b8e5UL, + 0x050d7ae4UL, 0x384a26efUL, 0x0f20e4eeUL, 0x569ea2ecUL, 0x61f460edUL, + 0xe4e22fe8UL, 0xd388ede9UL, 0x8a36abebUL, 0xbd5c69eaUL, 0xf0b813fdUL, + 0xc7d2d1fcUL, 0x9e6c97feUL, 0xa90655ffUL, 0x2c101afaUL, 0x1b7ad8fbUL, + 0x42c49ef9UL, 0x75ae5cf8UL, 0x48e900f3UL, 0x7f83c2f2UL, 0x263d84f0UL, + 0x115746f1UL, 0x944109f4UL, 0xa32bcbf5UL, 0xfa958df7UL, 0xcdff4ff6UL, + 0x605d78d9UL, 0x5737bad8UL, 0x0e89fcdaUL, 0x39e33edbUL, 0xbcf571deUL, + 0x8b9fb3dfUL, 0xd221f5ddUL, 0xe54b37dcUL, 0xd80c6bd7UL, 0xef66a9d6UL, + 0xb6d8efd4UL, 0x81b22dd5UL, 0x04a462d0UL, 0x33cea0d1UL, 0x6a70e6d3UL, + 0x5d1a24d2UL, 0x10fe5ec5UL, 0x27949cc4UL, 0x7e2adac6UL, 0x494018c7UL, + 0xcc5657c2UL, 0xfb3c95c3UL, 0xa282d3c1UL, 0x95e811c0UL, 0xa8af4dcbUL, + 0x9fc58fcaUL, 0xc67bc9c8UL, 0xf1110bc9UL, 0x740744ccUL, 0x436d86cdUL, + 0x1ad3c0cfUL, 0x2db902ceUL, 0x4096af91UL, 0x77fc6d90UL, 0x2e422b92UL, + 0x1928e993UL, 0x9c3ea696UL, 0xab546497UL, 0xf2ea2295UL, 0xc580e094UL, + 0xf8c7bc9fUL, 0xcfad7e9eUL, 0x9613389cUL, 0xa179fa9dUL, 0x246fb598UL, + 0x13057799UL, 0x4abb319bUL, 0x7dd1f39aUL, 0x3035898dUL, 0x075f4b8cUL, + 0x5ee10d8eUL, 0x698bcf8fUL, 0xec9d808aUL, 0xdbf7428bUL, 0x82490489UL, + 0xb523c688UL, 0x88649a83UL, 0xbf0e5882UL, 0xe6b01e80UL, 0xd1dadc81UL, + 0x54cc9384UL, 0x63a65185UL, 0x3a181787UL, 0x0d72d586UL, 0xa0d0e2a9UL, + 0x97ba20a8UL, 0xce0466aaUL, 0xf96ea4abUL, 0x7c78ebaeUL, 0x4b1229afUL, + 0x12ac6fadUL, 0x25c6adacUL, 0x1881f1a7UL, 0x2feb33a6UL, 0x765575a4UL, + 0x413fb7a5UL, 0xc429f8a0UL, 0xf3433aa1UL, 0xaafd7ca3UL, 0x9d97bea2UL, + 0xd073c4b5UL, 0xe71906b4UL, 0xbea740b6UL, 0x89cd82b7UL, 0x0cdbcdb2UL, + 0x3bb10fb3UL, 0x620f49b1UL, 0x55658bb0UL, 0x6822d7bbUL, 0x5f4815baUL, + 0x06f653b8UL, 0x319c91b9UL, 0xb48adebcUL, 0x83e01cbdUL, 0xda5e5abfUL, + 0xed3498beUL + }, + { + 0x00000000UL, 0x6567bcb8UL, 0x8bc809aaUL, 0xeeafb512UL, 0x5797628fUL, + 0x32f0de37UL, 0xdc5f6b25UL, 0xb938d79dUL, 0xef28b4c5UL, 0x8a4f087dUL, + 0x64e0bd6fUL, 0x018701d7UL, 0xb8bfd64aUL, 0xddd86af2UL, 0x3377dfe0UL, + 0x56106358UL, 0x9f571950UL, 0xfa30a5e8UL, 0x149f10faUL, 0x71f8ac42UL, + 0xc8c07bdfUL, 0xada7c767UL, 0x43087275UL, 0x266fcecdUL, 0x707fad95UL, + 0x1518112dUL, 0xfbb7a43fUL, 0x9ed01887UL, 0x27e8cf1aUL, 0x428f73a2UL, + 0xac20c6b0UL, 0xc9477a08UL, 0x3eaf32a0UL, 0x5bc88e18UL, 0xb5673b0aUL, + 0xd00087b2UL, 0x6938502fUL, 0x0c5fec97UL, 0xe2f05985UL, 0x8797e53dUL, + 0xd1878665UL, 0xb4e03addUL, 0x5a4f8fcfUL, 0x3f283377UL, 0x8610e4eaUL, + 0xe3775852UL, 0x0dd8ed40UL, 0x68bf51f8UL, 0xa1f82bf0UL, 0xc49f9748UL, + 0x2a30225aUL, 0x4f579ee2UL, 0xf66f497fUL, 0x9308f5c7UL, 0x7da740d5UL, + 0x18c0fc6dUL, 0x4ed09f35UL, 0x2bb7238dUL, 0xc518969fUL, 0xa07f2a27UL, + 0x1947fdbaUL, 0x7c204102UL, 0x928ff410UL, 0xf7e848a8UL, 0x3d58149bUL, + 0x583fa823UL, 0xb6901d31UL, 0xd3f7a189UL, 0x6acf7614UL, 0x0fa8caacUL, + 0xe1077fbeUL, 0x8460c306UL, 0xd270a05eUL, 0xb7171ce6UL, 0x59b8a9f4UL, + 0x3cdf154cUL, 0x85e7c2d1UL, 0xe0807e69UL, 0x0e2fcb7bUL, 0x6b4877c3UL, + 0xa20f0dcbUL, 0xc768b173UL, 0x29c70461UL, 0x4ca0b8d9UL, 0xf5986f44UL, + 0x90ffd3fcUL, 0x7e5066eeUL, 0x1b37da56UL, 0x4d27b90eUL, 0x284005b6UL, + 0xc6efb0a4UL, 0xa3880c1cUL, 0x1ab0db81UL, 0x7fd76739UL, 0x9178d22bUL, + 0xf41f6e93UL, 0x03f7263bUL, 0x66909a83UL, 0x883f2f91UL, 0xed589329UL, + 0x546044b4UL, 0x3107f80cUL, 0xdfa84d1eUL, 0xbacff1a6UL, 0xecdf92feUL, + 0x89b82e46UL, 0x67179b54UL, 0x027027ecUL, 0xbb48f071UL, 0xde2f4cc9UL, + 0x3080f9dbUL, 0x55e74563UL, 0x9ca03f6bUL, 0xf9c783d3UL, 0x176836c1UL, + 0x720f8a79UL, 0xcb375de4UL, 0xae50e15cUL, 0x40ff544eUL, 0x2598e8f6UL, + 0x73888baeUL, 0x16ef3716UL, 0xf8408204UL, 0x9d273ebcUL, 0x241fe921UL, + 0x41785599UL, 0xafd7e08bUL, 0xcab05c33UL, 0x3bb659edUL, 0x5ed1e555UL, + 0xb07e5047UL, 0xd519ecffUL, 0x6c213b62UL, 0x094687daUL, 0xe7e932c8UL, + 0x828e8e70UL, 0xd49eed28UL, 0xb1f95190UL, 0x5f56e482UL, 0x3a31583aUL, + 0x83098fa7UL, 0xe66e331fUL, 0x08c1860dUL, 0x6da63ab5UL, 0xa4e140bdUL, + 0xc186fc05UL, 0x2f294917UL, 0x4a4ef5afUL, 0xf3762232UL, 0x96119e8aUL, + 0x78be2b98UL, 0x1dd99720UL, 0x4bc9f478UL, 0x2eae48c0UL, 0xc001fdd2UL, + 0xa566416aUL, 0x1c5e96f7UL, 0x79392a4fUL, 0x97969f5dUL, 0xf2f123e5UL, + 0x05196b4dUL, 0x607ed7f5UL, 0x8ed162e7UL, 0xebb6de5fUL, 0x528e09c2UL, + 0x37e9b57aUL, 0xd9460068UL, 0xbc21bcd0UL, 0xea31df88UL, 0x8f566330UL, + 0x61f9d622UL, 0x049e6a9aUL, 0xbda6bd07UL, 0xd8c101bfUL, 0x366eb4adUL, + 0x53090815UL, 0x9a4e721dUL, 0xff29cea5UL, 0x11867bb7UL, 0x74e1c70fUL, + 0xcdd91092UL, 0xa8beac2aUL, 0x46111938UL, 0x2376a580UL, 0x7566c6d8UL, + 0x10017a60UL, 0xfeaecf72UL, 0x9bc973caUL, 0x22f1a457UL, 0x479618efUL, + 0xa939adfdUL, 0xcc5e1145UL, 0x06ee4d76UL, 0x6389f1ceUL, 0x8d2644dcUL, + 0xe841f864UL, 0x51792ff9UL, 0x341e9341UL, 0xdab12653UL, 0xbfd69aebUL, + 0xe9c6f9b3UL, 0x8ca1450bUL, 0x620ef019UL, 0x07694ca1UL, 0xbe519b3cUL, + 0xdb362784UL, 0x35999296UL, 0x50fe2e2eUL, 0x99b95426UL, 0xfcdee89eUL, + 0x12715d8cUL, 0x7716e134UL, 0xce2e36a9UL, 0xab498a11UL, 0x45e63f03UL, + 0x208183bbUL, 0x7691e0e3UL, 0x13f65c5bUL, 0xfd59e949UL, 0x983e55f1UL, + 0x2106826cUL, 0x44613ed4UL, 0xaace8bc6UL, 0xcfa9377eUL, 0x38417fd6UL, + 0x5d26c36eUL, 0xb389767cUL, 0xd6eecac4UL, 0x6fd61d59UL, 0x0ab1a1e1UL, + 0xe41e14f3UL, 0x8179a84bUL, 0xd769cb13UL, 0xb20e77abUL, 0x5ca1c2b9UL, + 0x39c67e01UL, 0x80fea99cUL, 0xe5991524UL, 0x0b36a036UL, 0x6e511c8eUL, + 0xa7166686UL, 0xc271da3eUL, 0x2cde6f2cUL, 0x49b9d394UL, 0xf0810409UL, + 0x95e6b8b1UL, 0x7b490da3UL, 0x1e2eb11bUL, 0x483ed243UL, 0x2d596efbUL, + 0xc3f6dbe9UL, 0xa6916751UL, 0x1fa9b0ccUL, 0x7ace0c74UL, 0x9461b966UL, + 0xf10605deUL +#endif + } +}; diff --git a/PdbChecker/zlib/deflate.c b/PdbChecker/zlib/deflate.c new file mode 100644 index 0000000..1ec7614 --- /dev/null +++ b/PdbChecker/zlib/deflate.c @@ -0,0 +1,2163 @@ +/* deflate.c -- compress data using the deflation algorithm + * Copyright (C) 1995-2017 Jean-loup Gailly and Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* + * ALGORITHM + * + * The "deflation" process depends on being able to identify portions + * of the input text which are identical to earlier input (within a + * sliding window trailing behind the input currently being processed). + * + * The most straightforward technique turns out to be the fastest for + * most input files: try all possible matches and select the longest. + * The key feature of this algorithm is that insertions into the string + * dictionary are very simple and thus fast, and deletions are avoided + * completely. Insertions are performed at each input character, whereas + * string matches are performed only when the previous match ends. So it + * is preferable to spend more time in matches to allow very fast string + * insertions and avoid deletions. The matching algorithm for small + * strings is inspired from that of Rabin & Karp. A brute force approach + * is used to find longer strings when a small match has been found. + * A similar algorithm is used in comic (by Jan-Mark Wams) and freeze + * (by Leonid Broukhis). + * A previous version of this file used a more sophisticated algorithm + * (by Fiala and Greene) which is guaranteed to run in linear amortized + * time, but has a larger average cost, uses more memory and is patented. + * However the F&G algorithm may be faster for some highly redundant + * files if the parameter max_chain_length (described below) is too large. + * + * ACKNOWLEDGEMENTS + * + * The idea of lazy evaluation of matches is due to Jan-Mark Wams, and + * I found it in 'freeze' written by Leonid Broukhis. + * Thanks to many people for bug reports and testing. + * + * REFERENCES + * + * Deutsch, L.P.,"DEFLATE Compressed Data Format Specification". + * Available in http://tools.ietf.org/html/rfc1951 + * + * A description of the Rabin and Karp algorithm is given in the book + * "Algorithms" by R. Sedgewick, Addison-Wesley, p252. + * + * Fiala,E.R., and Greene,D.H. + * Data Compression with Finite Windows, Comm.ACM, 32,4 (1989) 490-595 + * + */ + +/* @(#) $Id$ */ + +#include "deflate.h" + +const char deflate_copyright[] = + " deflate 1.2.11 Copyright 1995-2017 Jean-loup Gailly and Mark Adler "; +/* + If you use the zlib library in a product, an acknowledgment is welcome + in the documentation of your product. If for some reason you cannot + include such an acknowledgment, I would appreciate that you keep this + copyright string in the executable of your product. + */ + +/* =========================================================================== + * Function prototypes. + */ +typedef enum { + need_more, /* block not completed, need more input or more output */ + block_done, /* block flush performed */ + finish_started, /* finish started, need only more output at next deflate */ + finish_done /* finish done, accept no more input or output */ +} block_state; + +typedef block_state (*compress_func) OF((deflate_state *s, int flush)); +/* Compression function. Returns the block state after the call. */ + +local int deflateStateCheck OF((z_streamp strm)); +local void slide_hash OF((deflate_state *s)); +local void fill_window OF((deflate_state *s)); +local block_state deflate_stored OF((deflate_state *s, int flush)); +local block_state deflate_fast OF((deflate_state *s, int flush)); +#ifndef FASTEST +local block_state deflate_slow OF((deflate_state *s, int flush)); +#endif +local block_state deflate_rle OF((deflate_state *s, int flush)); +local block_state deflate_huff OF((deflate_state *s, int flush)); +local void lm_init OF((deflate_state *s)); +local void putShortMSB OF((deflate_state *s, uInt b)); +local void flush_pending OF((z_streamp strm)); +local unsigned read_buf OF((z_streamp strm, Bytef *buf, unsigned size)); +#ifdef ASMV +# pragma message("Assembler code may have bugs -- use at your own risk") + void match_init OF((void)); /* asm code initialization */ + uInt longest_match OF((deflate_state *s, IPos cur_match)); +#else +local uInt longest_match OF((deflate_state *s, IPos cur_match)); +#endif + +#ifdef ZLIB_DEBUG +local void check_match OF((deflate_state *s, IPos start, IPos match, + int length)); +#endif + +/* =========================================================================== + * Local data + */ + +#define NIL 0 +/* Tail of hash chains */ + +#ifndef TOO_FAR +# define TOO_FAR 4096 +#endif +/* Matches of length 3 are discarded if their distance exceeds TOO_FAR */ + +/* Values for max_lazy_match, good_match and max_chain_length, depending on + * the desired pack level (0..9). The values given below have been tuned to + * exclude worst case performance for pathological files. Better values may be + * found for specific files. + */ +typedef struct config_s { + ush good_length; /* reduce lazy search above this match length */ + ush max_lazy; /* do not perform lazy search above this match length */ + ush nice_length; /* quit search above this match length */ + ush max_chain; + compress_func func; +} config; + +#ifdef FASTEST +local const config configuration_table[2] = { +/* good lazy nice chain */ +/* 0 */ {0, 0, 0, 0, deflate_stored}, /* store only */ +/* 1 */ {4, 4, 8, 4, deflate_fast}}; /* max speed, no lazy matches */ +#else +local const config configuration_table[10] = { +/* good lazy nice chain */ +/* 0 */ {0, 0, 0, 0, deflate_stored}, /* store only */ +/* 1 */ {4, 4, 8, 4, deflate_fast}, /* max speed, no lazy matches */ +/* 2 */ {4, 5, 16, 8, deflate_fast}, +/* 3 */ {4, 6, 32, 32, deflate_fast}, + +/* 4 */ {4, 4, 16, 16, deflate_slow}, /* lazy matches */ +/* 5 */ {8, 16, 32, 32, deflate_slow}, +/* 6 */ {8, 16, 128, 128, deflate_slow}, +/* 7 */ {8, 32, 128, 256, deflate_slow}, +/* 8 */ {32, 128, 258, 1024, deflate_slow}, +/* 9 */ {32, 258, 258, 4096, deflate_slow}}; /* max compression */ +#endif + +/* Note: the deflate() code requires max_lazy >= MIN_MATCH and max_chain >= 4 + * For deflate_fast() (levels <= 3) good is ignored and lazy has a different + * meaning. + */ + +/* rank Z_BLOCK between Z_NO_FLUSH and Z_PARTIAL_FLUSH */ +#define RANK(f) (((f) * 2) - ((f) > 4 ? 9 : 0)) + +/* =========================================================================== + * Update a hash value with the given input byte + * IN assertion: all calls to UPDATE_HASH are made with consecutive input + * characters, so that a running hash key can be computed from the previous + * key instead of complete recalculation each time. + */ +#define UPDATE_HASH(s,h,c) (h = (((h)<hash_shift) ^ (c)) & s->hash_mask) + + +/* =========================================================================== + * Insert string str in the dictionary and set match_head to the previous head + * of the hash chain (the most recent string with same hash key). Return + * the previous length of the hash chain. + * If this file is compiled with -DFASTEST, the compression level is forced + * to 1, and no hash chains are maintained. + * IN assertion: all calls to INSERT_STRING are made with consecutive input + * characters and the first MIN_MATCH bytes of str are valid (except for + * the last MIN_MATCH-1 bytes of the input file). + */ +#ifdef FASTEST +#define INSERT_STRING(s, str, match_head) \ + (UPDATE_HASH(s, s->ins_h, s->window[(str) + (MIN_MATCH-1)]), \ + match_head = s->head[s->ins_h], \ + s->head[s->ins_h] = (Pos)(str)) +#else +#define INSERT_STRING(s, str, match_head) \ + (UPDATE_HASH(s, s->ins_h, s->window[(str) + (MIN_MATCH-1)]), \ + match_head = s->prev[(str) & s->w_mask] = s->head[s->ins_h], \ + s->head[s->ins_h] = (Pos)(str)) +#endif + +/* =========================================================================== + * Initialize the hash table (avoiding 64K overflow for 16 bit systems). + * prev[] will be initialized on the fly. + */ +#define CLEAR_HASH(s) \ + s->head[s->hash_size-1] = NIL; \ + zmemzero((Bytef *)s->head, (unsigned)(s->hash_size-1)*sizeof(*s->head)); + +/* =========================================================================== + * Slide the hash table when sliding the window down (could be avoided with 32 + * bit values at the expense of memory usage). We slide even when level == 0 to + * keep the hash table consistent if we switch back to level > 0 later. + */ +local void slide_hash(s) + deflate_state *s; +{ + unsigned n, m; + Posf *p; + uInt wsize = s->w_size; + + n = s->hash_size; + p = &s->head[n]; + do { + m = *--p; + *p = (Pos)(m >= wsize ? m - wsize : NIL); + } while (--n); + n = wsize; +#ifndef FASTEST + p = &s->prev[n]; + do { + m = *--p; + *p = (Pos)(m >= wsize ? m - wsize : NIL); + /* If n is not on any hash chain, prev[n] is garbage but + * its value will never be used. + */ + } while (--n); +#endif +} + +/* ========================================================================= */ +int ZEXPORT deflateInit_(strm, level, version, stream_size) + z_streamp strm; + int level; + const char *version; + int stream_size; +{ + return deflateInit2_(strm, level, Z_DEFLATED, MAX_WBITS, DEF_MEM_LEVEL, + Z_DEFAULT_STRATEGY, version, stream_size); + /* To do: ignore strm->next_in if we use it as window */ +} + +/* ========================================================================= */ +int ZEXPORT deflateInit2_(strm, level, method, windowBits, memLevel, strategy, + version, stream_size) + z_streamp strm; + int level; + int method; + int windowBits; + int memLevel; + int strategy; + const char *version; + int stream_size; +{ + deflate_state *s; + int wrap = 1; + static const char my_version[] = ZLIB_VERSION; + + ushf *overlay; + /* We overlay pending_buf and d_buf+l_buf. This works since the average + * output size for (length,distance) codes is <= 24 bits. + */ + + if (version == Z_NULL || version[0] != my_version[0] || + stream_size != sizeof(z_stream)) { + return Z_VERSION_ERROR; + } + if (strm == Z_NULL) return Z_STREAM_ERROR; + + strm->msg = Z_NULL; + if (strm->zalloc == (alloc_func)0) { +#ifdef Z_SOLO + return Z_STREAM_ERROR; +#else + strm->zalloc = zcalloc; + strm->opaque = (voidpf)0; +#endif + } + if (strm->zfree == (free_func)0) +#ifdef Z_SOLO + return Z_STREAM_ERROR; +#else + strm->zfree = zcfree; +#endif + +#ifdef FASTEST + if (level != 0) level = 1; +#else + if (level == Z_DEFAULT_COMPRESSION) level = 6; +#endif + + if (windowBits < 0) { /* suppress zlib wrapper */ + wrap = 0; + windowBits = -windowBits; + } +#ifdef GZIP + else if (windowBits > 15) { + wrap = 2; /* write gzip wrapper instead */ + windowBits -= 16; + } +#endif + if (memLevel < 1 || memLevel > MAX_MEM_LEVEL || method != Z_DEFLATED || + windowBits < 8 || windowBits > 15 || level < 0 || level > 9 || + strategy < 0 || strategy > Z_FIXED || (windowBits == 8 && wrap != 1)) { + return Z_STREAM_ERROR; + } + if (windowBits == 8) windowBits = 9; /* until 256-byte window bug fixed */ + s = (deflate_state *) ZALLOC(strm, 1, sizeof(deflate_state)); + if (s == Z_NULL) return Z_MEM_ERROR; + strm->state = (struct internal_state FAR *)s; + s->strm = strm; + s->status = INIT_STATE; /* to pass state test in deflateReset() */ + + s->wrap = wrap; + s->gzhead = Z_NULL; + s->w_bits = (uInt)windowBits; + s->w_size = 1 << s->w_bits; + s->w_mask = s->w_size - 1; + + s->hash_bits = (uInt)memLevel + 7; + s->hash_size = 1 << s->hash_bits; + s->hash_mask = s->hash_size - 1; + s->hash_shift = ((s->hash_bits+MIN_MATCH-1)/MIN_MATCH); + + s->window = (Bytef *) ZALLOC(strm, s->w_size, 2*sizeof(Byte)); + s->prev = (Posf *) ZALLOC(strm, s->w_size, sizeof(Pos)); + s->head = (Posf *) ZALLOC(strm, s->hash_size, sizeof(Pos)); + + s->high_water = 0; /* nothing written to s->window yet */ + + s->lit_bufsize = 1 << (memLevel + 6); /* 16K elements by default */ + + overlay = (ushf *) ZALLOC(strm, s->lit_bufsize, sizeof(ush)+2); + s->pending_buf = (uchf *) overlay; + s->pending_buf_size = (ulg)s->lit_bufsize * (sizeof(ush)+2L); + + if (s->window == Z_NULL || s->prev == Z_NULL || s->head == Z_NULL || + s->pending_buf == Z_NULL) { + s->status = FINISH_STATE; + strm->msg = ERR_MSG(Z_MEM_ERROR); + deflateEnd (strm); + return Z_MEM_ERROR; + } + s->d_buf = overlay + s->lit_bufsize/sizeof(ush); + s->l_buf = s->pending_buf + (1+sizeof(ush))*s->lit_bufsize; + + s->level = level; + s->strategy = strategy; + s->method = (Byte)method; + + return deflateReset(strm); +} + +/* ========================================================================= + * Check for a valid deflate stream state. Return 0 if ok, 1 if not. + */ +local int deflateStateCheck (strm) + z_streamp strm; +{ + deflate_state *s; + if (strm == Z_NULL || + strm->zalloc == (alloc_func)0 || strm->zfree == (free_func)0) + return 1; + s = strm->state; + if (s == Z_NULL || s->strm != strm || (s->status != INIT_STATE && +#ifdef GZIP + s->status != GZIP_STATE && +#endif + s->status != EXTRA_STATE && + s->status != NAME_STATE && + s->status != COMMENT_STATE && + s->status != HCRC_STATE && + s->status != BUSY_STATE && + s->status != FINISH_STATE)) + return 1; + return 0; +} + +/* ========================================================================= */ +int ZEXPORT deflateSetDictionary (strm, dictionary, dictLength) + z_streamp strm; + const Bytef *dictionary; + uInt dictLength; +{ + deflate_state *s; + uInt str, n; + int wrap; + unsigned avail; + z_const unsigned char *next; + + if (deflateStateCheck(strm) || dictionary == Z_NULL) + return Z_STREAM_ERROR; + s = strm->state; + wrap = s->wrap; + if (wrap == 2 || (wrap == 1 && s->status != INIT_STATE) || s->lookahead) + return Z_STREAM_ERROR; + + /* when using zlib wrappers, compute Adler-32 for provided dictionary */ + if (wrap == 1) + strm->adler = adler32(strm->adler, dictionary, dictLength); + s->wrap = 0; /* avoid computing Adler-32 in read_buf */ + + /* if dictionary would fill window, just replace the history */ + if (dictLength >= s->w_size) { + if (wrap == 0) { /* already empty otherwise */ + CLEAR_HASH(s); + s->strstart = 0; + s->block_start = 0L; + s->insert = 0; + } + dictionary += dictLength - s->w_size; /* use the tail */ + dictLength = s->w_size; + } + + /* insert dictionary into window and hash */ + avail = strm->avail_in; + next = strm->next_in; + strm->avail_in = dictLength; + strm->next_in = (z_const Bytef *)dictionary; + fill_window(s); + while (s->lookahead >= MIN_MATCH) { + str = s->strstart; + n = s->lookahead - (MIN_MATCH-1); + do { + UPDATE_HASH(s, s->ins_h, s->window[str + MIN_MATCH-1]); +#ifndef FASTEST + s->prev[str & s->w_mask] = s->head[s->ins_h]; +#endif + s->head[s->ins_h] = (Pos)str; + str++; + } while (--n); + s->strstart = str; + s->lookahead = MIN_MATCH-1; + fill_window(s); + } + s->strstart += s->lookahead; + s->block_start = (long)s->strstart; + s->insert = s->lookahead; + s->lookahead = 0; + s->match_length = s->prev_length = MIN_MATCH-1; + s->match_available = 0; + strm->next_in = next; + strm->avail_in = avail; + s->wrap = wrap; + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflateGetDictionary (strm, dictionary, dictLength) + z_streamp strm; + Bytef *dictionary; + uInt *dictLength; +{ + deflate_state *s; + uInt len; + + if (deflateStateCheck(strm)) + return Z_STREAM_ERROR; + s = strm->state; + len = s->strstart + s->lookahead; + if (len > s->w_size) + len = s->w_size; + if (dictionary != Z_NULL && len) + zmemcpy(dictionary, s->window + s->strstart + s->lookahead - len, len); + if (dictLength != Z_NULL) + *dictLength = len; + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflateResetKeep (strm) + z_streamp strm; +{ + deflate_state *s; + + if (deflateStateCheck(strm)) { + return Z_STREAM_ERROR; + } + + strm->total_in = strm->total_out = 0; + strm->msg = Z_NULL; /* use zfree if we ever allocate msg dynamically */ + strm->data_type = Z_UNKNOWN; + + s = (deflate_state *)strm->state; + s->pending = 0; + s->pending_out = s->pending_buf; + + if (s->wrap < 0) { + s->wrap = -s->wrap; /* was made negative by deflate(..., Z_FINISH); */ + } + s->status = +#ifdef GZIP + s->wrap == 2 ? GZIP_STATE : +#endif + s->wrap ? INIT_STATE : BUSY_STATE; + strm->adler = +#ifdef GZIP + s->wrap == 2 ? crc32(0L, Z_NULL, 0) : +#endif + adler32(0L, Z_NULL, 0); + s->last_flush = Z_NO_FLUSH; + + _tr_init(s); + + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflateReset (strm) + z_streamp strm; +{ + int ret; + + ret = deflateResetKeep(strm); + if (ret == Z_OK) + lm_init(strm->state); + return ret; +} + +/* ========================================================================= */ +int ZEXPORT deflateSetHeader (strm, head) + z_streamp strm; + gz_headerp head; +{ + if (deflateStateCheck(strm) || strm->state->wrap != 2) + return Z_STREAM_ERROR; + strm->state->gzhead = head; + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflatePending (strm, pending, bits) + unsigned *pending; + int *bits; + z_streamp strm; +{ + if (deflateStateCheck(strm)) return Z_STREAM_ERROR; + if (pending != Z_NULL) + *pending = strm->state->pending; + if (bits != Z_NULL) + *bits = strm->state->bi_valid; + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflatePrime (strm, bits, value) + z_streamp strm; + int bits; + int value; +{ + deflate_state *s; + int put; + + if (deflateStateCheck(strm)) return Z_STREAM_ERROR; + s = strm->state; + if ((Bytef *)(s->d_buf) < s->pending_out + ((Buf_size + 7) >> 3)) + return Z_BUF_ERROR; + do { + put = Buf_size - s->bi_valid; + if (put > bits) + put = bits; + s->bi_buf |= (ush)((value & ((1 << put) - 1)) << s->bi_valid); + s->bi_valid += put; + _tr_flush_bits(s); + value >>= put; + bits -= put; + } while (bits); + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflateParams(strm, level, strategy) + z_streamp strm; + int level; + int strategy; +{ + deflate_state *s; + compress_func func; + + if (deflateStateCheck(strm)) return Z_STREAM_ERROR; + s = strm->state; + +#ifdef FASTEST + if (level != 0) level = 1; +#else + if (level == Z_DEFAULT_COMPRESSION) level = 6; +#endif + if (level < 0 || level > 9 || strategy < 0 || strategy > Z_FIXED) { + return Z_STREAM_ERROR; + } + func = configuration_table[s->level].func; + + if ((strategy != s->strategy || func != configuration_table[level].func) && + s->high_water) { + /* Flush the last buffer: */ + int err = deflate(strm, Z_BLOCK); + if (err == Z_STREAM_ERROR) + return err; + if (strm->avail_out == 0) + return Z_BUF_ERROR; + } + if (s->level != level) { + if (s->level == 0 && s->matches != 0) { + if (s->matches == 1) + slide_hash(s); + else + CLEAR_HASH(s); + s->matches = 0; + } + s->level = level; + s->max_lazy_match = configuration_table[level].max_lazy; + s->good_match = configuration_table[level].good_length; + s->nice_match = configuration_table[level].nice_length; + s->max_chain_length = configuration_table[level].max_chain; + } + s->strategy = strategy; + return Z_OK; +} + +/* ========================================================================= */ +int ZEXPORT deflateTune(strm, good_length, max_lazy, nice_length, max_chain) + z_streamp strm; + int good_length; + int max_lazy; + int nice_length; + int max_chain; +{ + deflate_state *s; + + if (deflateStateCheck(strm)) return Z_STREAM_ERROR; + s = strm->state; + s->good_match = (uInt)good_length; + s->max_lazy_match = (uInt)max_lazy; + s->nice_match = nice_length; + s->max_chain_length = (uInt)max_chain; + return Z_OK; +} + +/* ========================================================================= + * For the default windowBits of 15 and memLevel of 8, this function returns + * a close to exact, as well as small, upper bound on the compressed size. + * They are coded as constants here for a reason--if the #define's are + * changed, then this function needs to be changed as well. The return + * value for 15 and 8 only works for those exact settings. + * + * For any setting other than those defaults for windowBits and memLevel, + * the value returned is a conservative worst case for the maximum expansion + * resulting from using fixed blocks instead of stored blocks, which deflate + * can emit on compressed data for some combinations of the parameters. + * + * This function could be more sophisticated to provide closer upper bounds for + * every combination of windowBits and memLevel. But even the conservative + * upper bound of about 14% expansion does not seem onerous for output buffer + * allocation. + */ +uLong ZEXPORT deflateBound(strm, sourceLen) + z_streamp strm; + uLong sourceLen; +{ + deflate_state *s; + uLong complen, wraplen; + + /* conservative upper bound for compressed data */ + complen = sourceLen + + ((sourceLen + 7) >> 3) + ((sourceLen + 63) >> 6) + 5; + + /* if can't get parameters, return conservative bound plus zlib wrapper */ + if (deflateStateCheck(strm)) + return complen + 6; + + /* compute wrapper length */ + s = strm->state; + switch (s->wrap) { + case 0: /* raw deflate */ + wraplen = 0; + break; + case 1: /* zlib wrapper */ + wraplen = 6 + (s->strstart ? 4 : 0); + break; +#ifdef GZIP + case 2: /* gzip wrapper */ + wraplen = 18; + if (s->gzhead != Z_NULL) { /* user-supplied gzip header */ + Bytef *str; + if (s->gzhead->extra != Z_NULL) + wraplen += 2 + s->gzhead->extra_len; + str = s->gzhead->name; + if (str != Z_NULL) + do { + wraplen++; + } while (*str++); + str = s->gzhead->comment; + if (str != Z_NULL) + do { + wraplen++; + } while (*str++); + if (s->gzhead->hcrc) + wraplen += 2; + } + break; +#endif + default: /* for compiler happiness */ + wraplen = 6; + } + + /* if not default parameters, return conservative bound */ + if (s->w_bits != 15 || s->hash_bits != 8 + 7) + return complen + wraplen; + + /* default settings: return tight bound for that case */ + return sourceLen + (sourceLen >> 12) + (sourceLen >> 14) + + (sourceLen >> 25) + 13 - 6 + wraplen; +} + +/* ========================================================================= + * Put a short in the pending buffer. The 16-bit value is put in MSB order. + * IN assertion: the stream state is correct and there is enough room in + * pending_buf. + */ +local void putShortMSB (s, b) + deflate_state *s; + uInt b; +{ + put_byte(s, (Byte)(b >> 8)); + put_byte(s, (Byte)(b & 0xff)); +} + +/* ========================================================================= + * Flush as much pending output as possible. All deflate() output, except for + * some deflate_stored() output, goes through this function so some + * applications may wish to modify it to avoid allocating a large + * strm->next_out buffer and copying into it. (See also read_buf()). + */ +local void flush_pending(strm) + z_streamp strm; +{ + unsigned len; + deflate_state *s = strm->state; + + _tr_flush_bits(s); + len = s->pending; + if (len > strm->avail_out) len = strm->avail_out; + if (len == 0) return; + + zmemcpy(strm->next_out, s->pending_out, len); + strm->next_out += len; + s->pending_out += len; + strm->total_out += len; + strm->avail_out -= len; + s->pending -= len; + if (s->pending == 0) { + s->pending_out = s->pending_buf; + } +} + +/* =========================================================================== + * Update the header CRC with the bytes s->pending_buf[beg..s->pending - 1]. + */ +#define HCRC_UPDATE(beg) \ + do { \ + if (s->gzhead->hcrc && s->pending > (beg)) \ + strm->adler = crc32(strm->adler, s->pending_buf + (beg), \ + s->pending - (beg)); \ + } while (0) + +/* ========================================================================= */ +int ZEXPORT deflate (strm, flush) + z_streamp strm; + int flush; +{ + int old_flush; /* value of flush param for previous deflate call */ + deflate_state *s; + + if (deflateStateCheck(strm) || flush > Z_BLOCK || flush < 0) { + return Z_STREAM_ERROR; + } + s = strm->state; + + if (strm->next_out == Z_NULL || + (strm->avail_in != 0 && strm->next_in == Z_NULL) || + (s->status == FINISH_STATE && flush != Z_FINISH)) { + ERR_RETURN(strm, Z_STREAM_ERROR); + } + if (strm->avail_out == 0) ERR_RETURN(strm, Z_BUF_ERROR); + + old_flush = s->last_flush; + s->last_flush = flush; + + /* Flush as much pending output as possible */ + if (s->pending != 0) { + flush_pending(strm); + if (strm->avail_out == 0) { + /* Since avail_out is 0, deflate will be called again with + * more output space, but possibly with both pending and + * avail_in equal to zero. There won't be anything to do, + * but this is not an error situation so make sure we + * return OK instead of BUF_ERROR at next call of deflate: + */ + s->last_flush = -1; + return Z_OK; + } + + /* Make sure there is something to do and avoid duplicate consecutive + * flushes. For repeated and useless calls with Z_FINISH, we keep + * returning Z_STREAM_END instead of Z_BUF_ERROR. + */ + } else if (strm->avail_in == 0 && RANK(flush) <= RANK(old_flush) && + flush != Z_FINISH) { + ERR_RETURN(strm, Z_BUF_ERROR); + } + + /* User must not provide more input after the first FINISH: */ + if (s->status == FINISH_STATE && strm->avail_in != 0) { + ERR_RETURN(strm, Z_BUF_ERROR); + } + + /* Write the header */ + if (s->status == INIT_STATE) { + /* zlib header */ + uInt header = (Z_DEFLATED + ((s->w_bits-8)<<4)) << 8; + uInt level_flags; + + if (s->strategy >= Z_HUFFMAN_ONLY || s->level < 2) + level_flags = 0; + else if (s->level < 6) + level_flags = 1; + else if (s->level == 6) + level_flags = 2; + else + level_flags = 3; + header |= (level_flags << 6); + if (s->strstart != 0) header |= PRESET_DICT; + header += 31 - (header % 31); + + putShortMSB(s, header); + + /* Save the adler32 of the preset dictionary: */ + if (s->strstart != 0) { + putShortMSB(s, (uInt)(strm->adler >> 16)); + putShortMSB(s, (uInt)(strm->adler & 0xffff)); + } + strm->adler = adler32(0L, Z_NULL, 0); + s->status = BUSY_STATE; + + /* Compression must start with an empty pending buffer */ + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + } +#ifdef GZIP + if (s->status == GZIP_STATE) { + /* gzip header */ + strm->adler = crc32(0L, Z_NULL, 0); + put_byte(s, 31); + put_byte(s, 139); + put_byte(s, 8); + if (s->gzhead == Z_NULL) { + put_byte(s, 0); + put_byte(s, 0); + put_byte(s, 0); + put_byte(s, 0); + put_byte(s, 0); + put_byte(s, s->level == 9 ? 2 : + (s->strategy >= Z_HUFFMAN_ONLY || s->level < 2 ? + 4 : 0)); + put_byte(s, OS_CODE); + s->status = BUSY_STATE; + + /* Compression must start with an empty pending buffer */ + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + } + else { + put_byte(s, (s->gzhead->text ? 1 : 0) + + (s->gzhead->hcrc ? 2 : 0) + + (s->gzhead->extra == Z_NULL ? 0 : 4) + + (s->gzhead->name == Z_NULL ? 0 : 8) + + (s->gzhead->comment == Z_NULL ? 0 : 16) + ); + put_byte(s, (Byte)(s->gzhead->time & 0xff)); + put_byte(s, (Byte)((s->gzhead->time >> 8) & 0xff)); + put_byte(s, (Byte)((s->gzhead->time >> 16) & 0xff)); + put_byte(s, (Byte)((s->gzhead->time >> 24) & 0xff)); + put_byte(s, s->level == 9 ? 2 : + (s->strategy >= Z_HUFFMAN_ONLY || s->level < 2 ? + 4 : 0)); + put_byte(s, s->gzhead->os & 0xff); + if (s->gzhead->extra != Z_NULL) { + put_byte(s, s->gzhead->extra_len & 0xff); + put_byte(s, (s->gzhead->extra_len >> 8) & 0xff); + } + if (s->gzhead->hcrc) + strm->adler = crc32(strm->adler, s->pending_buf, + s->pending); + s->gzindex = 0; + s->status = EXTRA_STATE; + } + } + if (s->status == EXTRA_STATE) { + if (s->gzhead->extra != Z_NULL) { + ulg beg = s->pending; /* start of bytes to update crc */ + uInt left = (s->gzhead->extra_len & 0xffff) - s->gzindex; + while (s->pending + left > s->pending_buf_size) { + uInt copy = s->pending_buf_size - s->pending; + zmemcpy(s->pending_buf + s->pending, + s->gzhead->extra + s->gzindex, copy); + s->pending = s->pending_buf_size; + HCRC_UPDATE(beg); + s->gzindex += copy; + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + beg = 0; + left -= copy; + } + zmemcpy(s->pending_buf + s->pending, + s->gzhead->extra + s->gzindex, left); + s->pending += left; + HCRC_UPDATE(beg); + s->gzindex = 0; + } + s->status = NAME_STATE; + } + if (s->status == NAME_STATE) { + if (s->gzhead->name != Z_NULL) { + ulg beg = s->pending; /* start of bytes to update crc */ + int val; + do { + if (s->pending == s->pending_buf_size) { + HCRC_UPDATE(beg); + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + beg = 0; + } + val = s->gzhead->name[s->gzindex++]; + put_byte(s, val); + } while (val != 0); + HCRC_UPDATE(beg); + s->gzindex = 0; + } + s->status = COMMENT_STATE; + } + if (s->status == COMMENT_STATE) { + if (s->gzhead->comment != Z_NULL) { + ulg beg = s->pending; /* start of bytes to update crc */ + int val; + do { + if (s->pending == s->pending_buf_size) { + HCRC_UPDATE(beg); + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + beg = 0; + } + val = s->gzhead->comment[s->gzindex++]; + put_byte(s, val); + } while (val != 0); + HCRC_UPDATE(beg); + } + s->status = HCRC_STATE; + } + if (s->status == HCRC_STATE) { + if (s->gzhead->hcrc) { + if (s->pending + 2 > s->pending_buf_size) { + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + } + put_byte(s, (Byte)(strm->adler & 0xff)); + put_byte(s, (Byte)((strm->adler >> 8) & 0xff)); + strm->adler = crc32(0L, Z_NULL, 0); + } + s->status = BUSY_STATE; + + /* Compression must start with an empty pending buffer */ + flush_pending(strm); + if (s->pending != 0) { + s->last_flush = -1; + return Z_OK; + } + } +#endif + + /* Start a new block or continue the current one. + */ + if (strm->avail_in != 0 || s->lookahead != 0 || + (flush != Z_NO_FLUSH && s->status != FINISH_STATE)) { + block_state bstate; + + bstate = s->level == 0 ? deflate_stored(s, flush) : + s->strategy == Z_HUFFMAN_ONLY ? deflate_huff(s, flush) : + s->strategy == Z_RLE ? deflate_rle(s, flush) : + (*(configuration_table[s->level].func))(s, flush); + + if (bstate == finish_started || bstate == finish_done) { + s->status = FINISH_STATE; + } + if (bstate == need_more || bstate == finish_started) { + if (strm->avail_out == 0) { + s->last_flush = -1; /* avoid BUF_ERROR next call, see above */ + } + return Z_OK; + /* If flush != Z_NO_FLUSH && avail_out == 0, the next call + * of deflate should use the same flush parameter to make sure + * that the flush is complete. So we don't have to output an + * empty block here, this will be done at next call. This also + * ensures that for a very small output buffer, we emit at most + * one empty block. + */ + } + if (bstate == block_done) { + if (flush == Z_PARTIAL_FLUSH) { + _tr_align(s); + } else if (flush != Z_BLOCK) { /* FULL_FLUSH or SYNC_FLUSH */ + _tr_stored_block(s, (char*)0, 0L, 0); + /* For a full flush, this empty block will be recognized + * as a special marker by inflate_sync(). + */ + if (flush == Z_FULL_FLUSH) { + CLEAR_HASH(s); /* forget history */ + if (s->lookahead == 0) { + s->strstart = 0; + s->block_start = 0L; + s->insert = 0; + } + } + } + flush_pending(strm); + if (strm->avail_out == 0) { + s->last_flush = -1; /* avoid BUF_ERROR at next call, see above */ + return Z_OK; + } + } + } + + if (flush != Z_FINISH) return Z_OK; + if (s->wrap <= 0) return Z_STREAM_END; + + /* Write the trailer */ +#ifdef GZIP + if (s->wrap == 2) { + put_byte(s, (Byte)(strm->adler & 0xff)); + put_byte(s, (Byte)((strm->adler >> 8) & 0xff)); + put_byte(s, (Byte)((strm->adler >> 16) & 0xff)); + put_byte(s, (Byte)((strm->adler >> 24) & 0xff)); + put_byte(s, (Byte)(strm->total_in & 0xff)); + put_byte(s, (Byte)((strm->total_in >> 8) & 0xff)); + put_byte(s, (Byte)((strm->total_in >> 16) & 0xff)); + put_byte(s, (Byte)((strm->total_in >> 24) & 0xff)); + } + else +#endif + { + putShortMSB(s, (uInt)(strm->adler >> 16)); + putShortMSB(s, (uInt)(strm->adler & 0xffff)); + } + flush_pending(strm); + /* If avail_out is zero, the application will call deflate again + * to flush the rest. + */ + if (s->wrap > 0) s->wrap = -s->wrap; /* write the trailer only once! */ + return s->pending != 0 ? Z_OK : Z_STREAM_END; +} + +/* ========================================================================= */ +int ZEXPORT deflateEnd (strm) + z_streamp strm; +{ + int status; + + if (deflateStateCheck(strm)) return Z_STREAM_ERROR; + + status = strm->state->status; + + /* Deallocate in reverse order of allocations: */ + TRY_FREE(strm, strm->state->pending_buf); + TRY_FREE(strm, strm->state->head); + TRY_FREE(strm, strm->state->prev); + TRY_FREE(strm, strm->state->window); + + ZFREE(strm, strm->state); + strm->state = Z_NULL; + + return status == BUSY_STATE ? Z_DATA_ERROR : Z_OK; +} + +/* ========================================================================= + * Copy the source state to the destination state. + * To simplify the source, this is not supported for 16-bit MSDOS (which + * doesn't have enough memory anyway to duplicate compression states). + */ +int ZEXPORT deflateCopy (dest, source) + z_streamp dest; + z_streamp source; +{ +#ifdef MAXSEG_64K + return Z_STREAM_ERROR; +#else + deflate_state *ds; + deflate_state *ss; + ushf *overlay; + + + if (deflateStateCheck(source) || dest == Z_NULL) { + return Z_STREAM_ERROR; + } + + ss = source->state; + + zmemcpy((voidpf)dest, (voidpf)source, sizeof(z_stream)); + + ds = (deflate_state *) ZALLOC(dest, 1, sizeof(deflate_state)); + if (ds == Z_NULL) return Z_MEM_ERROR; + dest->state = (struct internal_state FAR *) ds; + zmemcpy((voidpf)ds, (voidpf)ss, sizeof(deflate_state)); + ds->strm = dest; + + ds->window = (Bytef *) ZALLOC(dest, ds->w_size, 2*sizeof(Byte)); + ds->prev = (Posf *) ZALLOC(dest, ds->w_size, sizeof(Pos)); + ds->head = (Posf *) ZALLOC(dest, ds->hash_size, sizeof(Pos)); + overlay = (ushf *) ZALLOC(dest, ds->lit_bufsize, sizeof(ush)+2); + ds->pending_buf = (uchf *) overlay; + + if (ds->window == Z_NULL || ds->prev == Z_NULL || ds->head == Z_NULL || + ds->pending_buf == Z_NULL) { + deflateEnd (dest); + return Z_MEM_ERROR; + } + /* following zmemcpy do not work for 16-bit MSDOS */ + zmemcpy(ds->window, ss->window, ds->w_size * 2 * sizeof(Byte)); + zmemcpy((voidpf)ds->prev, (voidpf)ss->prev, ds->w_size * sizeof(Pos)); + zmemcpy((voidpf)ds->head, (voidpf)ss->head, ds->hash_size * sizeof(Pos)); + zmemcpy(ds->pending_buf, ss->pending_buf, (uInt)ds->pending_buf_size); + + ds->pending_out = ds->pending_buf + (ss->pending_out - ss->pending_buf); + ds->d_buf = overlay + ds->lit_bufsize/sizeof(ush); + ds->l_buf = ds->pending_buf + (1+sizeof(ush))*ds->lit_bufsize; + + ds->l_desc.dyn_tree = ds->dyn_ltree; + ds->d_desc.dyn_tree = ds->dyn_dtree; + ds->bl_desc.dyn_tree = ds->bl_tree; + + return Z_OK; +#endif /* MAXSEG_64K */ +} + +/* =========================================================================== + * Read a new buffer from the current input stream, update the adler32 + * and total number of bytes read. All deflate() input goes through + * this function so some applications may wish to modify it to avoid + * allocating a large strm->next_in buffer and copying from it. + * (See also flush_pending()). + */ +local unsigned read_buf(strm, buf, size) + z_streamp strm; + Bytef *buf; + unsigned size; +{ + unsigned len = strm->avail_in; + + if (len > size) len = size; + if (len == 0) return 0; + + strm->avail_in -= len; + + zmemcpy(buf, strm->next_in, len); + if (strm->state->wrap == 1) { + strm->adler = adler32(strm->adler, buf, len); + } +#ifdef GZIP + else if (strm->state->wrap == 2) { + strm->adler = crc32(strm->adler, buf, len); + } +#endif + strm->next_in += len; + strm->total_in += len; + + return len; +} + +/* =========================================================================== + * Initialize the "longest match" routines for a new zlib stream + */ +local void lm_init (s) + deflate_state *s; +{ + s->window_size = (ulg)2L*s->w_size; + + CLEAR_HASH(s); + + /* Set the default configuration parameters: + */ + s->max_lazy_match = configuration_table[s->level].max_lazy; + s->good_match = configuration_table[s->level].good_length; + s->nice_match = configuration_table[s->level].nice_length; + s->max_chain_length = configuration_table[s->level].max_chain; + + s->strstart = 0; + s->block_start = 0L; + s->lookahead = 0; + s->insert = 0; + s->match_length = s->prev_length = MIN_MATCH-1; + s->match_available = 0; + s->ins_h = 0; +#ifndef FASTEST +#ifdef ASMV + match_init(); /* initialize the asm code */ +#endif +#endif +} + +#ifndef FASTEST +/* =========================================================================== + * Set match_start to the longest match starting at the given string and + * return its length. Matches shorter or equal to prev_length are discarded, + * in which case the result is equal to prev_length and match_start is + * garbage. + * IN assertions: cur_match is the head of the hash chain for the current + * string (strstart) and its distance is <= MAX_DIST, and prev_length >= 1 + * OUT assertion: the match length is not greater than s->lookahead. + */ +#ifndef ASMV +/* For 80x86 and 680x0, an optimized version will be provided in match.asm or + * match.S. The code will be functionally equivalent. + */ +local uInt longest_match(s, cur_match) + deflate_state *s; + IPos cur_match; /* current match */ +{ + unsigned chain_length = s->max_chain_length;/* max hash chain length */ + register Bytef *scan = s->window + s->strstart; /* current string */ + register Bytef *match; /* matched string */ + register int len; /* length of current match */ + int best_len = (int)s->prev_length; /* best match length so far */ + int nice_match = s->nice_match; /* stop if match long enough */ + IPos limit = s->strstart > (IPos)MAX_DIST(s) ? + s->strstart - (IPos)MAX_DIST(s) : NIL; + /* Stop when cur_match becomes <= limit. To simplify the code, + * we prevent matches with the string of window index 0. + */ + Posf *prev = s->prev; + uInt wmask = s->w_mask; + +#ifdef UNALIGNED_OK + /* Compare two bytes at a time. Note: this is not always beneficial. + * Try with and without -DUNALIGNED_OK to check. + */ + register Bytef *strend = s->window + s->strstart + MAX_MATCH - 1; + register ush scan_start = *(ushf*)scan; + register ush scan_end = *(ushf*)(scan+best_len-1); +#else + register Bytef *strend = s->window + s->strstart + MAX_MATCH; + register Byte scan_end1 = scan[best_len-1]; + register Byte scan_end = scan[best_len]; +#endif + + /* The code is optimized for HASH_BITS >= 8 and MAX_MATCH-2 multiple of 16. + * It is easy to get rid of this optimization if necessary. + */ + Assert(s->hash_bits >= 8 && MAX_MATCH == 258, "Code too clever"); + + /* Do not waste too much time if we already have a good match: */ + if (s->prev_length >= s->good_match) { + chain_length >>= 2; + } + /* Do not look for matches beyond the end of the input. This is necessary + * to make deflate deterministic. + */ + if ((uInt)nice_match > s->lookahead) nice_match = (int)s->lookahead; + + Assert((ulg)s->strstart <= s->window_size-MIN_LOOKAHEAD, "need lookahead"); + + do { + Assert(cur_match < s->strstart, "no future"); + match = s->window + cur_match; + + /* Skip to next match if the match length cannot increase + * or if the match length is less than 2. Note that the checks below + * for insufficient lookahead only occur occasionally for performance + * reasons. Therefore uninitialized memory will be accessed, and + * conditional jumps will be made that depend on those values. + * However the length of the match is limited to the lookahead, so + * the output of deflate is not affected by the uninitialized values. + */ +#if (defined(UNALIGNED_OK) && MAX_MATCH == 258) + /* This code assumes sizeof(unsigned short) == 2. Do not use + * UNALIGNED_OK if your compiler uses a different size. + */ + if (*(ushf*)(match+best_len-1) != scan_end || + *(ushf*)match != scan_start) continue; + + /* It is not necessary to compare scan[2] and match[2] since they are + * always equal when the other bytes match, given that the hash keys + * are equal and that HASH_BITS >= 8. Compare 2 bytes at a time at + * strstart+3, +5, ... up to strstart+257. We check for insufficient + * lookahead only every 4th comparison; the 128th check will be made + * at strstart+257. If MAX_MATCH-2 is not a multiple of 8, it is + * necessary to put more guard bytes at the end of the window, or + * to check more often for insufficient lookahead. + */ + Assert(scan[2] == match[2], "scan[2]?"); + scan++, match++; + do { + } while (*(ushf*)(scan+=2) == *(ushf*)(match+=2) && + *(ushf*)(scan+=2) == *(ushf*)(match+=2) && + *(ushf*)(scan+=2) == *(ushf*)(match+=2) && + *(ushf*)(scan+=2) == *(ushf*)(match+=2) && + scan < strend); + /* The funny "do {}" generates better code on most compilers */ + + /* Here, scan <= window+strstart+257 */ + Assert(scan <= s->window+(unsigned)(s->window_size-1), "wild scan"); + if (*scan == *match) scan++; + + len = (MAX_MATCH - 1) - (int)(strend-scan); + scan = strend - (MAX_MATCH-1); + +#else /* UNALIGNED_OK */ + + if (match[best_len] != scan_end || + match[best_len-1] != scan_end1 || + *match != *scan || + *++match != scan[1]) continue; + + /* The check at best_len-1 can be removed because it will be made + * again later. (This heuristic is not always a win.) + * It is not necessary to compare scan[2] and match[2] since they + * are always equal when the other bytes match, given that + * the hash keys are equal and that HASH_BITS >= 8. + */ + scan += 2, match++; + Assert(*scan == *match, "match[2]?"); + + /* We check for insufficient lookahead only every 8th comparison; + * the 256th check will be made at strstart+258. + */ + do { + } while (*++scan == *++match && *++scan == *++match && + *++scan == *++match && *++scan == *++match && + *++scan == *++match && *++scan == *++match && + *++scan == *++match && *++scan == *++match && + scan < strend); + + Assert(scan <= s->window+(unsigned)(s->window_size-1), "wild scan"); + + len = MAX_MATCH - (int)(strend - scan); + scan = strend - MAX_MATCH; + +#endif /* UNALIGNED_OK */ + + if (len > best_len) { + s->match_start = cur_match; + best_len = len; + if (len >= nice_match) break; +#ifdef UNALIGNED_OK + scan_end = *(ushf*)(scan+best_len-1); +#else + scan_end1 = scan[best_len-1]; + scan_end = scan[best_len]; +#endif + } + } while ((cur_match = prev[cur_match & wmask]) > limit + && --chain_length != 0); + + if ((uInt)best_len <= s->lookahead) return (uInt)best_len; + return s->lookahead; +} +#endif /* ASMV */ + +#else /* FASTEST */ + +/* --------------------------------------------------------------------------- + * Optimized version for FASTEST only + */ +local uInt longest_match(s, cur_match) + deflate_state *s; + IPos cur_match; /* current match */ +{ + register Bytef *scan = s->window + s->strstart; /* current string */ + register Bytef *match; /* matched string */ + register int len; /* length of current match */ + register Bytef *strend = s->window + s->strstart + MAX_MATCH; + + /* The code is optimized for HASH_BITS >= 8 and MAX_MATCH-2 multiple of 16. + * It is easy to get rid of this optimization if necessary. + */ + Assert(s->hash_bits >= 8 && MAX_MATCH == 258, "Code too clever"); + + Assert((ulg)s->strstart <= s->window_size-MIN_LOOKAHEAD, "need lookahead"); + + Assert(cur_match < s->strstart, "no future"); + + match = s->window + cur_match; + + /* Return failure if the match length is less than 2: + */ + if (match[0] != scan[0] || match[1] != scan[1]) return MIN_MATCH-1; + + /* The check at best_len-1 can be removed because it will be made + * again later. (This heuristic is not always a win.) + * It is not necessary to compare scan[2] and match[2] since they + * are always equal when the other bytes match, given that + * the hash keys are equal and that HASH_BITS >= 8. + */ + scan += 2, match += 2; + Assert(*scan == *match, "match[2]?"); + + /* We check for insufficient lookahead only every 8th comparison; + * the 256th check will be made at strstart+258. + */ + do { + } while (*++scan == *++match && *++scan == *++match && + *++scan == *++match && *++scan == *++match && + *++scan == *++match && *++scan == *++match && + *++scan == *++match && *++scan == *++match && + scan < strend); + + Assert(scan <= s->window+(unsigned)(s->window_size-1), "wild scan"); + + len = MAX_MATCH - (int)(strend - scan); + + if (len < MIN_MATCH) return MIN_MATCH - 1; + + s->match_start = cur_match; + return (uInt)len <= s->lookahead ? (uInt)len : s->lookahead; +} + +#endif /* FASTEST */ + +#ifdef ZLIB_DEBUG + +#define EQUAL 0 +/* result of memcmp for equal strings */ + +/* =========================================================================== + * Check that the match at match_start is indeed a match. + */ +local void check_match(s, start, match, length) + deflate_state *s; + IPos start, match; + int length; +{ + /* check that the match is indeed a match */ + if (zmemcmp(s->window + match, + s->window + start, length) != EQUAL) { + fprintf(stderr, " start %u, match %u, length %d\n", + start, match, length); + do { + fprintf(stderr, "%c%c", s->window[match++], s->window[start++]); + } while (--length != 0); + z_error("invalid match"); + } + if (z_verbose > 1) { + fprintf(stderr,"\\[%d,%d]", start-match, length); + do { putc(s->window[start++], stderr); } while (--length != 0); + } +} +#else +# define check_match(s, start, match, length) +#endif /* ZLIB_DEBUG */ + +/* =========================================================================== + * Fill the window when the lookahead becomes insufficient. + * Updates strstart and lookahead. + * + * IN assertion: lookahead < MIN_LOOKAHEAD + * OUT assertions: strstart <= window_size-MIN_LOOKAHEAD + * At least one byte has been read, or avail_in == 0; reads are + * performed for at least two bytes (required for the zip translate_eol + * option -- not supported here). + */ +local void fill_window(s) + deflate_state *s; +{ + unsigned n; + unsigned more; /* Amount of free space at the end of the window. */ + uInt wsize = s->w_size; + + Assert(s->lookahead < MIN_LOOKAHEAD, "already enough lookahead"); + + do { + more = (unsigned)(s->window_size -(ulg)s->lookahead -(ulg)s->strstart); + + /* Deal with !@#$% 64K limit: */ + if (sizeof(int) <= 2) { + if (more == 0 && s->strstart == 0 && s->lookahead == 0) { + more = wsize; + + } else if (more == (unsigned)(-1)) { + /* Very unlikely, but possible on 16 bit machine if + * strstart == 0 && lookahead == 1 (input done a byte at time) + */ + more--; + } + } + + /* If the window is almost full and there is insufficient lookahead, + * move the upper half to the lower one to make room in the upper half. + */ + if (s->strstart >= wsize+MAX_DIST(s)) { + + zmemcpy(s->window, s->window+wsize, (unsigned)wsize - more); + s->match_start -= wsize; + s->strstart -= wsize; /* we now have strstart >= MAX_DIST */ + s->block_start -= (long) wsize; + slide_hash(s); + more += wsize; + } + if (s->strm->avail_in == 0) break; + + /* If there was no sliding: + * strstart <= WSIZE+MAX_DIST-1 && lookahead <= MIN_LOOKAHEAD - 1 && + * more == window_size - lookahead - strstart + * => more >= window_size - (MIN_LOOKAHEAD-1 + WSIZE + MAX_DIST-1) + * => more >= window_size - 2*WSIZE + 2 + * In the BIG_MEM or MMAP case (not yet supported), + * window_size == input_size + MIN_LOOKAHEAD && + * strstart + s->lookahead <= input_size => more >= MIN_LOOKAHEAD. + * Otherwise, window_size == 2*WSIZE so more >= 2. + * If there was sliding, more >= WSIZE. So in all cases, more >= 2. + */ + Assert(more >= 2, "more < 2"); + + n = read_buf(s->strm, s->window + s->strstart + s->lookahead, more); + s->lookahead += n; + + /* Initialize the hash value now that we have some input: */ + if (s->lookahead + s->insert >= MIN_MATCH) { + uInt str = s->strstart - s->insert; + s->ins_h = s->window[str]; + UPDATE_HASH(s, s->ins_h, s->window[str + 1]); +#if MIN_MATCH != 3 + Call UPDATE_HASH() MIN_MATCH-3 more times +#endif + while (s->insert) { + UPDATE_HASH(s, s->ins_h, s->window[str + MIN_MATCH-1]); +#ifndef FASTEST + s->prev[str & s->w_mask] = s->head[s->ins_h]; +#endif + s->head[s->ins_h] = (Pos)str; + str++; + s->insert--; + if (s->lookahead + s->insert < MIN_MATCH) + break; + } + } + /* If the whole input has less than MIN_MATCH bytes, ins_h is garbage, + * but this is not important since only literal bytes will be emitted. + */ + + } while (s->lookahead < MIN_LOOKAHEAD && s->strm->avail_in != 0); + + /* If the WIN_INIT bytes after the end of the current data have never been + * written, then zero those bytes in order to avoid memory check reports of + * the use of uninitialized (or uninitialised as Julian writes) bytes by + * the longest match routines. Update the high water mark for the next + * time through here. WIN_INIT is set to MAX_MATCH since the longest match + * routines allow scanning to strstart + MAX_MATCH, ignoring lookahead. + */ + if (s->high_water < s->window_size) { + ulg curr = s->strstart + (ulg)(s->lookahead); + ulg init; + + if (s->high_water < curr) { + /* Previous high water mark below current data -- zero WIN_INIT + * bytes or up to end of window, whichever is less. + */ + init = s->window_size - curr; + if (init > WIN_INIT) + init = WIN_INIT; + zmemzero(s->window + curr, (unsigned)init); + s->high_water = curr + init; + } + else if (s->high_water < (ulg)curr + WIN_INIT) { + /* High water mark at or above current data, but below current data + * plus WIN_INIT -- zero out to current data plus WIN_INIT, or up + * to end of window, whichever is less. + */ + init = (ulg)curr + WIN_INIT - s->high_water; + if (init > s->window_size - s->high_water) + init = s->window_size - s->high_water; + zmemzero(s->window + s->high_water, (unsigned)init); + s->high_water += init; + } + } + + Assert((ulg)s->strstart <= s->window_size - MIN_LOOKAHEAD, + "not enough room for search"); +} + +/* =========================================================================== + * Flush the current block, with given end-of-file flag. + * IN assertion: strstart is set to the end of the current match. + */ +#define FLUSH_BLOCK_ONLY(s, last) { \ + _tr_flush_block(s, (s->block_start >= 0L ? \ + (charf *)&s->window[(unsigned)s->block_start] : \ + (charf *)Z_NULL), \ + (ulg)((long)s->strstart - s->block_start), \ + (last)); \ + s->block_start = s->strstart; \ + flush_pending(s->strm); \ + Tracev((stderr,"[FLUSH]")); \ +} + +/* Same but force premature exit if necessary. */ +#define FLUSH_BLOCK(s, last) { \ + FLUSH_BLOCK_ONLY(s, last); \ + if (s->strm->avail_out == 0) return (last) ? finish_started : need_more; \ +} + +/* Maximum stored block length in deflate format (not including header). */ +#define MAX_STORED 65535 + +/* Minimum of a and b. */ +#define MIN(a, b) ((a) > (b) ? (b) : (a)) + +/* =========================================================================== + * Copy without compression as much as possible from the input stream, return + * the current block state. + * + * In case deflateParams() is used to later switch to a non-zero compression + * level, s->matches (otherwise unused when storing) keeps track of the number + * of hash table slides to perform. If s->matches is 1, then one hash table + * slide will be done when switching. If s->matches is 2, the maximum value + * allowed here, then the hash table will be cleared, since two or more slides + * is the same as a clear. + * + * deflate_stored() is written to minimize the number of times an input byte is + * copied. It is most efficient with large input and output buffers, which + * maximizes the opportunites to have a single copy from next_in to next_out. + */ +local block_state deflate_stored(s, flush) + deflate_state *s; + int flush; +{ + /* Smallest worthy block size when not flushing or finishing. By default + * this is 32K. This can be as small as 507 bytes for memLevel == 1. For + * large input and output buffers, the stored block size will be larger. + */ + unsigned min_block = MIN(s->pending_buf_size - 5, s->w_size); + + /* Copy as many min_block or larger stored blocks directly to next_out as + * possible. If flushing, copy the remaining available input to next_out as + * stored blocks, if there is enough space. + */ + unsigned len, left, have, last = 0; + unsigned used = s->strm->avail_in; + do { + /* Set len to the maximum size block that we can copy directly with the + * available input data and output space. Set left to how much of that + * would be copied from what's left in the window. + */ + len = MAX_STORED; /* maximum deflate stored block length */ + have = (s->bi_valid + 42) >> 3; /* number of header bytes */ + if (s->strm->avail_out < have) /* need room for header */ + break; + /* maximum stored block length that will fit in avail_out: */ + have = s->strm->avail_out - have; + left = s->strstart - s->block_start; /* bytes left in window */ + if (len > (ulg)left + s->strm->avail_in) + len = left + s->strm->avail_in; /* limit len to the input */ + if (len > have) + len = have; /* limit len to the output */ + + /* If the stored block would be less than min_block in length, or if + * unable to copy all of the available input when flushing, then try + * copying to the window and the pending buffer instead. Also don't + * write an empty block when flushing -- deflate() does that. + */ + if (len < min_block && ((len == 0 && flush != Z_FINISH) || + flush == Z_NO_FLUSH || + len != left + s->strm->avail_in)) + break; + + /* Make a dummy stored block in pending to get the header bytes, + * including any pending bits. This also updates the debugging counts. + */ + last = flush == Z_FINISH && len == left + s->strm->avail_in ? 1 : 0; + _tr_stored_block(s, (char *)0, 0L, last); + + /* Replace the lengths in the dummy stored block with len. */ + s->pending_buf[s->pending - 4] = len; + s->pending_buf[s->pending - 3] = len >> 8; + s->pending_buf[s->pending - 2] = ~len; + s->pending_buf[s->pending - 1] = ~len >> 8; + + /* Write the stored block header bytes. */ + flush_pending(s->strm); + +#ifdef ZLIB_DEBUG + /* Update debugging counts for the data about to be copied. */ + s->compressed_len += len << 3; + s->bits_sent += len << 3; +#endif + + /* Copy uncompressed bytes from the window to next_out. */ + if (left) { + if (left > len) + left = len; + zmemcpy(s->strm->next_out, s->window + s->block_start, left); + s->strm->next_out += left; + s->strm->avail_out -= left; + s->strm->total_out += left; + s->block_start += left; + len -= left; + } + + /* Copy uncompressed bytes directly from next_in to next_out, updating + * the check value. + */ + if (len) { + read_buf(s->strm, s->strm->next_out, len); + s->strm->next_out += len; + s->strm->avail_out -= len; + s->strm->total_out += len; + } + } while (last == 0); + + /* Update the sliding window with the last s->w_size bytes of the copied + * data, or append all of the copied data to the existing window if less + * than s->w_size bytes were copied. Also update the number of bytes to + * insert in the hash tables, in the event that deflateParams() switches to + * a non-zero compression level. + */ + used -= s->strm->avail_in; /* number of input bytes directly copied */ + if (used) { + /* If any input was used, then no unused input remains in the window, + * therefore s->block_start == s->strstart. + */ + if (used >= s->w_size) { /* supplant the previous history */ + s->matches = 2; /* clear hash */ + zmemcpy(s->window, s->strm->next_in - s->w_size, s->w_size); + s->strstart = s->w_size; + } + else { + if (s->window_size - s->strstart <= used) { + /* Slide the window down. */ + s->strstart -= s->w_size; + zmemcpy(s->window, s->window + s->w_size, s->strstart); + if (s->matches < 2) + s->matches++; /* add a pending slide_hash() */ + } + zmemcpy(s->window + s->strstart, s->strm->next_in - used, used); + s->strstart += used; + } + s->block_start = s->strstart; + s->insert += MIN(used, s->w_size - s->insert); + } + if (s->high_water < s->strstart) + s->high_water = s->strstart; + + /* If the last block was written to next_out, then done. */ + if (last) + return finish_done; + + /* If flushing and all input has been consumed, then done. */ + if (flush != Z_NO_FLUSH && flush != Z_FINISH && + s->strm->avail_in == 0 && (long)s->strstart == s->block_start) + return block_done; + + /* Fill the window with any remaining input. */ + have = s->window_size - s->strstart - 1; + if (s->strm->avail_in > have && s->block_start >= (long)s->w_size) { + /* Slide the window down. */ + s->block_start -= s->w_size; + s->strstart -= s->w_size; + zmemcpy(s->window, s->window + s->w_size, s->strstart); + if (s->matches < 2) + s->matches++; /* add a pending slide_hash() */ + have += s->w_size; /* more space now */ + } + if (have > s->strm->avail_in) + have = s->strm->avail_in; + if (have) { + read_buf(s->strm, s->window + s->strstart, have); + s->strstart += have; + } + if (s->high_water < s->strstart) + s->high_water = s->strstart; + + /* There was not enough avail_out to write a complete worthy or flushed + * stored block to next_out. Write a stored block to pending instead, if we + * have enough input for a worthy block, or if flushing and there is enough + * room for the remaining input as a stored block in the pending buffer. + */ + have = (s->bi_valid + 42) >> 3; /* number of header bytes */ + /* maximum stored block length that will fit in pending: */ + have = MIN(s->pending_buf_size - have, MAX_STORED); + min_block = MIN(have, s->w_size); + left = s->strstart - s->block_start; + if (left >= min_block || + ((left || flush == Z_FINISH) && flush != Z_NO_FLUSH && + s->strm->avail_in == 0 && left <= have)) { + len = MIN(left, have); + last = flush == Z_FINISH && s->strm->avail_in == 0 && + len == left ? 1 : 0; + _tr_stored_block(s, (charf *)s->window + s->block_start, len, last); + s->block_start += len; + flush_pending(s->strm); + } + + /* We've done all we can with the available input and output. */ + return last ? finish_started : need_more; +} + +/* =========================================================================== + * Compress as much as possible from the input stream, return the current + * block state. + * This function does not perform lazy evaluation of matches and inserts + * new strings in the dictionary only for unmatched strings or for short + * matches. It is used only for the fast compression options. + */ +local block_state deflate_fast(s, flush) + deflate_state *s; + int flush; +{ + IPos hash_head; /* head of the hash chain */ + int bflush; /* set if current block must be flushed */ + + for (;;) { + /* Make sure that we always have enough lookahead, except + * at the end of the input file. We need MAX_MATCH bytes + * for the next match, plus MIN_MATCH bytes to insert the + * string following the next match. + */ + if (s->lookahead < MIN_LOOKAHEAD) { + fill_window(s); + if (s->lookahead < MIN_LOOKAHEAD && flush == Z_NO_FLUSH) { + return need_more; + } + if (s->lookahead == 0) break; /* flush the current block */ + } + + /* Insert the string window[strstart .. strstart+2] in the + * dictionary, and set hash_head to the head of the hash chain: + */ + hash_head = NIL; + if (s->lookahead >= MIN_MATCH) { + INSERT_STRING(s, s->strstart, hash_head); + } + + /* Find the longest match, discarding those <= prev_length. + * At this point we have always match_length < MIN_MATCH + */ + if (hash_head != NIL && s->strstart - hash_head <= MAX_DIST(s)) { + /* To simplify the code, we prevent matches with the string + * of window index 0 (in particular we have to avoid a match + * of the string with itself at the start of the input file). + */ + s->match_length = longest_match (s, hash_head); + /* longest_match() sets match_start */ + } + if (s->match_length >= MIN_MATCH) { + check_match(s, s->strstart, s->match_start, s->match_length); + + _tr_tally_dist(s, s->strstart - s->match_start, + s->match_length - MIN_MATCH, bflush); + + s->lookahead -= s->match_length; + + /* Insert new strings in the hash table only if the match length + * is not too large. This saves time but degrades compression. + */ +#ifndef FASTEST + if (s->match_length <= s->max_insert_length && + s->lookahead >= MIN_MATCH) { + s->match_length--; /* string at strstart already in table */ + do { + s->strstart++; + INSERT_STRING(s, s->strstart, hash_head); + /* strstart never exceeds WSIZE-MAX_MATCH, so there are + * always MIN_MATCH bytes ahead. + */ + } while (--s->match_length != 0); + s->strstart++; + } else +#endif + { + s->strstart += s->match_length; + s->match_length = 0; + s->ins_h = s->window[s->strstart]; + UPDATE_HASH(s, s->ins_h, s->window[s->strstart+1]); +#if MIN_MATCH != 3 + Call UPDATE_HASH() MIN_MATCH-3 more times +#endif + /* If lookahead < MIN_MATCH, ins_h is garbage, but it does not + * matter since it will be recomputed at next deflate call. + */ + } + } else { + /* No match, output a literal byte */ + Tracevv((stderr,"%c", s->window[s->strstart])); + _tr_tally_lit (s, s->window[s->strstart], bflush); + s->lookahead--; + s->strstart++; + } + if (bflush) FLUSH_BLOCK(s, 0); + } + s->insert = s->strstart < MIN_MATCH-1 ? s->strstart : MIN_MATCH-1; + if (flush == Z_FINISH) { + FLUSH_BLOCK(s, 1); + return finish_done; + } + if (s->last_lit) + FLUSH_BLOCK(s, 0); + return block_done; +} + +#ifndef FASTEST +/* =========================================================================== + * Same as above, but achieves better compression. We use a lazy + * evaluation for matches: a match is finally adopted only if there is + * no better match at the next window position. + */ +local block_state deflate_slow(s, flush) + deflate_state *s; + int flush; +{ + IPos hash_head; /* head of hash chain */ + int bflush; /* set if current block must be flushed */ + + /* Process the input block. */ + for (;;) { + /* Make sure that we always have enough lookahead, except + * at the end of the input file. We need MAX_MATCH bytes + * for the next match, plus MIN_MATCH bytes to insert the + * string following the next match. + */ + if (s->lookahead < MIN_LOOKAHEAD) { + fill_window(s); + if (s->lookahead < MIN_LOOKAHEAD && flush == Z_NO_FLUSH) { + return need_more; + } + if (s->lookahead == 0) break; /* flush the current block */ + } + + /* Insert the string window[strstart .. strstart+2] in the + * dictionary, and set hash_head to the head of the hash chain: + */ + hash_head = NIL; + if (s->lookahead >= MIN_MATCH) { + INSERT_STRING(s, s->strstart, hash_head); + } + + /* Find the longest match, discarding those <= prev_length. + */ + s->prev_length = s->match_length, s->prev_match = s->match_start; + s->match_length = MIN_MATCH-1; + + if (hash_head != NIL && s->prev_length < s->max_lazy_match && + s->strstart - hash_head <= MAX_DIST(s)) { + /* To simplify the code, we prevent matches with the string + * of window index 0 (in particular we have to avoid a match + * of the string with itself at the start of the input file). + */ + s->match_length = longest_match (s, hash_head); + /* longest_match() sets match_start */ + + if (s->match_length <= 5 && (s->strategy == Z_FILTERED +#if TOO_FAR <= 32767 + || (s->match_length == MIN_MATCH && + s->strstart - s->match_start > TOO_FAR) +#endif + )) { + + /* If prev_match is also MIN_MATCH, match_start is garbage + * but we will ignore the current match anyway. + */ + s->match_length = MIN_MATCH-1; + } + } + /* If there was a match at the previous step and the current + * match is not better, output the previous match: + */ + if (s->prev_length >= MIN_MATCH && s->match_length <= s->prev_length) { + uInt max_insert = s->strstart + s->lookahead - MIN_MATCH; + /* Do not insert strings in hash table beyond this. */ + + check_match(s, s->strstart-1, s->prev_match, s->prev_length); + + _tr_tally_dist(s, s->strstart -1 - s->prev_match, + s->prev_length - MIN_MATCH, bflush); + + /* Insert in hash table all strings up to the end of the match. + * strstart-1 and strstart are already inserted. If there is not + * enough lookahead, the last two strings are not inserted in + * the hash table. + */ + s->lookahead -= s->prev_length-1; + s->prev_length -= 2; + do { + if (++s->strstart <= max_insert) { + INSERT_STRING(s, s->strstart, hash_head); + } + } while (--s->prev_length != 0); + s->match_available = 0; + s->match_length = MIN_MATCH-1; + s->strstart++; + + if (bflush) FLUSH_BLOCK(s, 0); + + } else if (s->match_available) { + /* If there was no match at the previous position, output a + * single literal. If there was a match but the current match + * is longer, truncate the previous match to a single literal. + */ + Tracevv((stderr,"%c", s->window[s->strstart-1])); + _tr_tally_lit(s, s->window[s->strstart-1], bflush); + if (bflush) { + FLUSH_BLOCK_ONLY(s, 0); + } + s->strstart++; + s->lookahead--; + if (s->strm->avail_out == 0) return need_more; + } else { + /* There is no previous match to compare with, wait for + * the next step to decide. + */ + s->match_available = 1; + s->strstart++; + s->lookahead--; + } + } + Assert (flush != Z_NO_FLUSH, "no flush?"); + if (s->match_available) { + Tracevv((stderr,"%c", s->window[s->strstart-1])); + _tr_tally_lit(s, s->window[s->strstart-1], bflush); + s->match_available = 0; + } + s->insert = s->strstart < MIN_MATCH-1 ? s->strstart : MIN_MATCH-1; + if (flush == Z_FINISH) { + FLUSH_BLOCK(s, 1); + return finish_done; + } + if (s->last_lit) + FLUSH_BLOCK(s, 0); + return block_done; +} +#endif /* FASTEST */ + +/* =========================================================================== + * For Z_RLE, simply look for runs of bytes, generate matches only of distance + * one. Do not maintain a hash table. (It will be regenerated if this run of + * deflate switches away from Z_RLE.) + */ +local block_state deflate_rle(s, flush) + deflate_state *s; + int flush; +{ + int bflush; /* set if current block must be flushed */ + uInt prev; /* byte at distance one to match */ + Bytef *scan, *strend; /* scan goes up to strend for length of run */ + + for (;;) { + /* Make sure that we always have enough lookahead, except + * at the end of the input file. We need MAX_MATCH bytes + * for the longest run, plus one for the unrolled loop. + */ + if (s->lookahead <= MAX_MATCH) { + fill_window(s); + if (s->lookahead <= MAX_MATCH && flush == Z_NO_FLUSH) { + return need_more; + } + if (s->lookahead == 0) break; /* flush the current block */ + } + + /* See how many times the previous byte repeats */ + s->match_length = 0; + if (s->lookahead >= MIN_MATCH && s->strstart > 0) { + scan = s->window + s->strstart - 1; + prev = *scan; + if (prev == *++scan && prev == *++scan && prev == *++scan) { + strend = s->window + s->strstart + MAX_MATCH; + do { + } while (prev == *++scan && prev == *++scan && + prev == *++scan && prev == *++scan && + prev == *++scan && prev == *++scan && + prev == *++scan && prev == *++scan && + scan < strend); + s->match_length = MAX_MATCH - (uInt)(strend - scan); + if (s->match_length > s->lookahead) + s->match_length = s->lookahead; + } + Assert(scan <= s->window+(uInt)(s->window_size-1), "wild scan"); + } + + /* Emit match if have run of MIN_MATCH or longer, else emit literal */ + if (s->match_length >= MIN_MATCH) { + check_match(s, s->strstart, s->strstart - 1, s->match_length); + + _tr_tally_dist(s, 1, s->match_length - MIN_MATCH, bflush); + + s->lookahead -= s->match_length; + s->strstart += s->match_length; + s->match_length = 0; + } else { + /* No match, output a literal byte */ + Tracevv((stderr,"%c", s->window[s->strstart])); + _tr_tally_lit (s, s->window[s->strstart], bflush); + s->lookahead--; + s->strstart++; + } + if (bflush) FLUSH_BLOCK(s, 0); + } + s->insert = 0; + if (flush == Z_FINISH) { + FLUSH_BLOCK(s, 1); + return finish_done; + } + if (s->last_lit) + FLUSH_BLOCK(s, 0); + return block_done; +} + +/* =========================================================================== + * For Z_HUFFMAN_ONLY, do not look for matches. Do not maintain a hash table. + * (It will be regenerated if this run of deflate switches away from Huffman.) + */ +local block_state deflate_huff(s, flush) + deflate_state *s; + int flush; +{ + int bflush; /* set if current block must be flushed */ + + for (;;) { + /* Make sure that we have a literal to write. */ + if (s->lookahead == 0) { + fill_window(s); + if (s->lookahead == 0) { + if (flush == Z_NO_FLUSH) + return need_more; + break; /* flush the current block */ + } + } + + /* Output a literal byte */ + s->match_length = 0; + Tracevv((stderr,"%c", s->window[s->strstart])); + _tr_tally_lit (s, s->window[s->strstart], bflush); + s->lookahead--; + s->strstart++; + if (bflush) FLUSH_BLOCK(s, 0); + } + s->insert = 0; + if (flush == Z_FINISH) { + FLUSH_BLOCK(s, 1); + return finish_done; + } + if (s->last_lit) + FLUSH_BLOCK(s, 0); + return block_done; +} diff --git a/PdbChecker/zlib/deflate.h b/PdbChecker/zlib/deflate.h new file mode 100644 index 0000000..23ecdd3 --- /dev/null +++ b/PdbChecker/zlib/deflate.h @@ -0,0 +1,349 @@ +/* deflate.h -- internal compression state + * Copyright (C) 1995-2016 Jean-loup Gailly + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* WARNING: this file should *not* be used by applications. It is + part of the implementation of the compression library and is + subject to change. Applications should only use zlib.h. + */ + +/* @(#) $Id$ */ + +#ifndef DEFLATE_H +#define DEFLATE_H + +#include "zutil.h" + +/* define NO_GZIP when compiling if you want to disable gzip header and + trailer creation by deflate(). NO_GZIP would be used to avoid linking in + the crc code when it is not needed. For shared libraries, gzip encoding + should be left enabled. */ +#ifndef NO_GZIP +# define GZIP +#endif + +/* =========================================================================== + * Internal compression state. + */ + +#define LENGTH_CODES 29 +/* number of length codes, not counting the special END_BLOCK code */ + +#define LITERALS 256 +/* number of literal bytes 0..255 */ + +#define L_CODES (LITERALS+1+LENGTH_CODES) +/* number of Literal or Length codes, including the END_BLOCK code */ + +#define D_CODES 30 +/* number of distance codes */ + +#define BL_CODES 19 +/* number of codes used to transfer the bit lengths */ + +#define HEAP_SIZE (2*L_CODES+1) +/* maximum heap size */ + +#define MAX_BITS 15 +/* All codes must not exceed MAX_BITS bits */ + +#define Buf_size 16 +/* size of bit buffer in bi_buf */ + +#define INIT_STATE 42 /* zlib header -> BUSY_STATE */ +#ifdef GZIP +# define GZIP_STATE 57 /* gzip header -> BUSY_STATE | EXTRA_STATE */ +#endif +#define EXTRA_STATE 69 /* gzip extra block -> NAME_STATE */ +#define NAME_STATE 73 /* gzip file name -> COMMENT_STATE */ +#define COMMENT_STATE 91 /* gzip comment -> HCRC_STATE */ +#define HCRC_STATE 103 /* gzip header CRC -> BUSY_STATE */ +#define BUSY_STATE 113 /* deflate -> FINISH_STATE */ +#define FINISH_STATE 666 /* stream complete */ +/* Stream status */ + + +/* Data structure describing a single value and its code string. */ +typedef struct ct_data_s { + union { + ush freq; /* frequency count */ + ush code; /* bit string */ + } fc; + union { + ush dad; /* father node in Huffman tree */ + ush len; /* length of bit string */ + } dl; +} FAR ct_data; + +#define Freq fc.freq +#define Code fc.code +#define Dad dl.dad +#define Len dl.len + +typedef struct static_tree_desc_s static_tree_desc; + +typedef struct tree_desc_s { + ct_data *dyn_tree; /* the dynamic tree */ + int max_code; /* largest code with non zero frequency */ + const static_tree_desc *stat_desc; /* the corresponding static tree */ +} FAR tree_desc; + +typedef ush Pos; +typedef Pos FAR Posf; +typedef unsigned IPos; + +/* A Pos is an index in the character window. We use short instead of int to + * save space in the various tables. IPos is used only for parameter passing. + */ + +typedef struct internal_state { + z_streamp strm; /* pointer back to this zlib stream */ + int status; /* as the name implies */ + Bytef *pending_buf; /* output still pending */ + ulg pending_buf_size; /* size of pending_buf */ + Bytef *pending_out; /* next pending byte to output to the stream */ + ulg pending; /* nb of bytes in the pending buffer */ + int wrap; /* bit 0 true for zlib, bit 1 true for gzip */ + gz_headerp gzhead; /* gzip header information to write */ + ulg gzindex; /* where in extra, name, or comment */ + Byte method; /* can only be DEFLATED */ + int last_flush; /* value of flush param for previous deflate call */ + + /* used by deflate.c: */ + + uInt w_size; /* LZ77 window size (32K by default) */ + uInt w_bits; /* log2(w_size) (8..16) */ + uInt w_mask; /* w_size - 1 */ + + Bytef *window; + /* Sliding window. Input bytes are read into the second half of the window, + * and move to the first half later to keep a dictionary of at least wSize + * bytes. With this organization, matches are limited to a distance of + * wSize-MAX_MATCH bytes, but this ensures that IO is always + * performed with a length multiple of the block size. Also, it limits + * the window size to 64K, which is quite useful on MSDOS. + * To do: use the user input buffer as sliding window. + */ + + ulg window_size; + /* Actual size of window: 2*wSize, except when the user input buffer + * is directly used as sliding window. + */ + + Posf *prev; + /* Link to older string with same hash index. To limit the size of this + * array to 64K, this link is maintained only for the last 32K strings. + * An index in this array is thus a window index modulo 32K. + */ + + Posf *head; /* Heads of the hash chains or NIL. */ + + uInt ins_h; /* hash index of string to be inserted */ + uInt hash_size; /* number of elements in hash table */ + uInt hash_bits; /* log2(hash_size) */ + uInt hash_mask; /* hash_size-1 */ + + uInt hash_shift; + /* Number of bits by which ins_h must be shifted at each input + * step. It must be such that after MIN_MATCH steps, the oldest + * byte no longer takes part in the hash key, that is: + * hash_shift * MIN_MATCH >= hash_bits + */ + + long block_start; + /* Window position at the beginning of the current output block. Gets + * negative when the window is moved backwards. + */ + + uInt match_length; /* length of best match */ + IPos prev_match; /* previous match */ + int match_available; /* set if previous match exists */ + uInt strstart; /* start of string to insert */ + uInt match_start; /* start of matching string */ + uInt lookahead; /* number of valid bytes ahead in window */ + + uInt prev_length; + /* Length of the best match at previous step. Matches not greater than this + * are discarded. This is used in the lazy match evaluation. + */ + + uInt max_chain_length; + /* To speed up deflation, hash chains are never searched beyond this + * length. A higher limit improves compression ratio but degrades the + * speed. + */ + + uInt max_lazy_match; + /* Attempt to find a better match only when the current match is strictly + * smaller than this value. This mechanism is used only for compression + * levels >= 4. + */ +# define max_insert_length max_lazy_match + /* Insert new strings in the hash table only if the match length is not + * greater than this length. This saves time but degrades compression. + * max_insert_length is used only for compression levels <= 3. + */ + + int level; /* compression level (1..9) */ + int strategy; /* favor or force Huffman coding*/ + + uInt good_match; + /* Use a faster search when the previous match is longer than this */ + + int nice_match; /* Stop searching when current match exceeds this */ + + /* used by trees.c: */ + /* Didn't use ct_data typedef below to suppress compiler warning */ + struct ct_data_s dyn_ltree[HEAP_SIZE]; /* literal and length tree */ + struct ct_data_s dyn_dtree[2*D_CODES+1]; /* distance tree */ + struct ct_data_s bl_tree[2*BL_CODES+1]; /* Huffman tree for bit lengths */ + + struct tree_desc_s l_desc; /* desc. for literal tree */ + struct tree_desc_s d_desc; /* desc. for distance tree */ + struct tree_desc_s bl_desc; /* desc. for bit length tree */ + + ush bl_count[MAX_BITS+1]; + /* number of codes at each bit length for an optimal tree */ + + int heap[2*L_CODES+1]; /* heap used to build the Huffman trees */ + int heap_len; /* number of elements in the heap */ + int heap_max; /* element of largest frequency */ + /* The sons of heap[n] are heap[2*n] and heap[2*n+1]. heap[0] is not used. + * The same heap array is used to build all trees. + */ + + uch depth[2*L_CODES+1]; + /* Depth of each subtree used as tie breaker for trees of equal frequency + */ + + uchf *l_buf; /* buffer for literals or lengths */ + + uInt lit_bufsize; + /* Size of match buffer for literals/lengths. There are 4 reasons for + * limiting lit_bufsize to 64K: + * - frequencies can be kept in 16 bit counters + * - if compression is not successful for the first block, all input + * data is still in the window so we can still emit a stored block even + * when input comes from standard input. (This can also be done for + * all blocks if lit_bufsize is not greater than 32K.) + * - if compression is not successful for a file smaller than 64K, we can + * even emit a stored file instead of a stored block (saving 5 bytes). + * This is applicable only for zip (not gzip or zlib). + * - creating new Huffman trees less frequently may not provide fast + * adaptation to changes in the input data statistics. (Take for + * example a binary file with poorly compressible code followed by + * a highly compressible string table.) Smaller buffer sizes give + * fast adaptation but have of course the overhead of transmitting + * trees more frequently. + * - I can't count above 4 + */ + + uInt last_lit; /* running index in l_buf */ + + ushf *d_buf; + /* Buffer for distances. To simplify the code, d_buf and l_buf have + * the same number of elements. To use different lengths, an extra flag + * array would be necessary. + */ + + ulg opt_len; /* bit length of current block with optimal trees */ + ulg static_len; /* bit length of current block with static trees */ + uInt matches; /* number of string matches in current block */ + uInt insert; /* bytes at end of window left to insert */ + +#ifdef ZLIB_DEBUG + ulg compressed_len; /* total bit length of compressed file mod 2^32 */ + ulg bits_sent; /* bit length of compressed data sent mod 2^32 */ +#endif + + ush bi_buf; + /* Output buffer. bits are inserted starting at the bottom (least + * significant bits). + */ + int bi_valid; + /* Number of valid bits in bi_buf. All bits above the last valid bit + * are always zero. + */ + + ulg high_water; + /* High water mark offset in window for initialized bytes -- bytes above + * this are set to zero in order to avoid memory check warnings when + * longest match routines access bytes past the input. This is then + * updated to the new high water mark. + */ + +} FAR deflate_state; + +/* Output a byte on the stream. + * IN assertion: there is enough room in pending_buf. + */ +#define put_byte(s, c) {s->pending_buf[s->pending++] = (Bytef)(c);} + + +#define MIN_LOOKAHEAD (MAX_MATCH+MIN_MATCH+1) +/* Minimum amount of lookahead, except at the end of the input file. + * See deflate.c for comments about the MIN_MATCH+1. + */ + +#define MAX_DIST(s) ((s)->w_size-MIN_LOOKAHEAD) +/* In order to simplify the code, particularly on 16 bit machines, match + * distances are limited to MAX_DIST instead of WSIZE. + */ + +#define WIN_INIT MAX_MATCH +/* Number of bytes after end of data in window to initialize in order to avoid + memory checker errors from longest match routines */ + + /* in trees.c */ +void ZLIB_INTERNAL _tr_init OF((deflate_state *s)); +int ZLIB_INTERNAL _tr_tally OF((deflate_state *s, unsigned dist, unsigned lc)); +void ZLIB_INTERNAL _tr_flush_block OF((deflate_state *s, charf *buf, + ulg stored_len, int last)); +void ZLIB_INTERNAL _tr_flush_bits OF((deflate_state *s)); +void ZLIB_INTERNAL _tr_align OF((deflate_state *s)); +void ZLIB_INTERNAL _tr_stored_block OF((deflate_state *s, charf *buf, + ulg stored_len, int last)); + +#define d_code(dist) \ + ((dist) < 256 ? _dist_code[dist] : _dist_code[256+((dist)>>7)]) +/* Mapping from a distance to a distance code. dist is the distance - 1 and + * must not have side effects. _dist_code[256] and _dist_code[257] are never + * used. + */ + +#ifndef ZLIB_DEBUG +/* Inline versions of _tr_tally for speed: */ + +#if defined(GEN_TREES_H) || !defined(STDC) + extern uch ZLIB_INTERNAL _length_code[]; + extern uch ZLIB_INTERNAL _dist_code[]; +#else + extern const uch ZLIB_INTERNAL _length_code[]; + extern const uch ZLIB_INTERNAL _dist_code[]; +#endif + +# define _tr_tally_lit(s, c, flush) \ + { uch cc = (c); \ + s->d_buf[s->last_lit] = 0; \ + s->l_buf[s->last_lit++] = cc; \ + s->dyn_ltree[cc].Freq++; \ + flush = (s->last_lit == s->lit_bufsize-1); \ + } +# define _tr_tally_dist(s, distance, length, flush) \ + { uch len = (uch)(length); \ + ush dist = (ush)(distance); \ + s->d_buf[s->last_lit] = dist; \ + s->l_buf[s->last_lit++] = len; \ + dist--; \ + s->dyn_ltree[_length_code[len]+LITERALS+1].Freq++; \ + s->dyn_dtree[d_code(dist)].Freq++; \ + flush = (s->last_lit == s->lit_bufsize-1); \ + } +#else +# define _tr_tally_lit(s, c, flush) flush = _tr_tally(s, 0, c) +# define _tr_tally_dist(s, distance, length, flush) \ + flush = _tr_tally(s, distance, length) +#endif + +#endif /* DEFLATE_H */ diff --git a/PdbChecker/zlib/gzguts.h b/PdbChecker/zlib/gzguts.h new file mode 100644 index 0000000..990a4d2 --- /dev/null +++ b/PdbChecker/zlib/gzguts.h @@ -0,0 +1,218 @@ +/* gzguts.h -- zlib internal header definitions for gz* operations + * Copyright (C) 2004, 2005, 2010, 2011, 2012, 2013, 2016 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +#ifdef _LARGEFILE64_SOURCE +# ifndef _LARGEFILE_SOURCE +# define _LARGEFILE_SOURCE 1 +# endif +# ifdef _FILE_OFFSET_BITS +# undef _FILE_OFFSET_BITS +# endif +#endif + +#ifdef HAVE_HIDDEN +# define ZLIB_INTERNAL __attribute__((visibility ("hidden"))) +#else +# define ZLIB_INTERNAL +#endif + +#include +#include "zlib.h" +#ifdef STDC +# include +# include +# include +#endif + +#ifndef _POSIX_SOURCE +# define _POSIX_SOURCE +#endif +#include + +#ifdef _WIN32 +# include +#endif + +#if defined(__TURBOC__) || defined(_MSC_VER) || defined(_WIN32) +# include +#endif + +#if defined(_WIN32) || defined(__CYGWIN__) +# define WIDECHAR +#endif + +#ifdef WINAPI_FAMILY +# define open _open +# define read _read +# define write _write +# define close _close +#endif + +#ifdef NO_DEFLATE /* for compatibility with old definition */ +# define NO_GZCOMPRESS +#endif + +#if defined(STDC99) || (defined(__TURBOC__) && __TURBOC__ >= 0x550) +# ifndef HAVE_VSNPRINTF +# define HAVE_VSNPRINTF +# endif +#endif + +#if defined(__CYGWIN__) +# ifndef HAVE_VSNPRINTF +# define HAVE_VSNPRINTF +# endif +#endif + +#if defined(MSDOS) && defined(__BORLANDC__) && (BORLANDC > 0x410) +# ifndef HAVE_VSNPRINTF +# define HAVE_VSNPRINTF +# endif +#endif + +#ifndef HAVE_VSNPRINTF +# ifdef MSDOS +/* vsnprintf may exist on some MS-DOS compilers (DJGPP?), + but for now we just assume it doesn't. */ +# define NO_vsnprintf +# endif +# ifdef __TURBOC__ +# define NO_vsnprintf +# endif +# ifdef WIN32 +/* In Win32, vsnprintf is available as the "non-ANSI" _vsnprintf. */ +# if !defined(vsnprintf) && !defined(NO_vsnprintf) +# if !defined(_MSC_VER) || ( defined(_MSC_VER) && _MSC_VER < 1500 ) +# define vsnprintf _vsnprintf +# endif +# endif +# endif +# ifdef __SASC +# define NO_vsnprintf +# endif +# ifdef VMS +# define NO_vsnprintf +# endif +# ifdef __OS400__ +# define NO_vsnprintf +# endif +# ifdef __MVS__ +# define NO_vsnprintf +# endif +#endif + +/* unlike snprintf (which is required in C99), _snprintf does not guarantee + null termination of the result -- however this is only used in gzlib.c where + the result is assured to fit in the space provided */ +#if defined(_MSC_VER) && _MSC_VER < 1900 +# define snprintf _snprintf +#endif + +#ifndef local +# define local static +#endif +/* since "static" is used to mean two completely different things in C, we + define "local" for the non-static meaning of "static", for readability + (compile with -Dlocal if your debugger can't find static symbols) */ + +/* gz* functions always use library allocation functions */ +#ifndef STDC + extern voidp malloc OF((uInt size)); + extern void free OF((voidpf ptr)); +#endif + +/* get errno and strerror definition */ +#if defined UNDER_CE +# include +# define zstrerror() gz_strwinerror((DWORD)GetLastError()) +#else +# ifndef NO_STRERROR +# include +# define zstrerror() strerror(errno) +# else +# define zstrerror() "stdio error (consult errno)" +# endif +#endif + +/* provide prototypes for these when building zlib without LFS */ +#if !defined(_LARGEFILE64_SOURCE) || _LFS64_LARGEFILE-0 == 0 + ZEXTERN gzFile ZEXPORT gzopen64 OF((const char *, const char *)); + ZEXTERN z_off64_t ZEXPORT gzseek64 OF((gzFile, z_off64_t, int)); + ZEXTERN z_off64_t ZEXPORT gztell64 OF((gzFile)); + ZEXTERN z_off64_t ZEXPORT gzoffset64 OF((gzFile)); +#endif + +/* default memLevel */ +#if MAX_MEM_LEVEL >= 8 +# define DEF_MEM_LEVEL 8 +#else +# define DEF_MEM_LEVEL MAX_MEM_LEVEL +#endif + +/* default i/o buffer size -- double this for output when reading (this and + twice this must be able to fit in an unsigned type) */ +#define GZBUFSIZE 8192 + +/* gzip modes, also provide a little integrity check on the passed structure */ +#define GZ_NONE 0 +#define GZ_READ 7247 +#define GZ_WRITE 31153 +#define GZ_APPEND 1 /* mode set to GZ_WRITE after the file is opened */ + +/* values for gz_state how */ +#define LOOK 0 /* look for a gzip header */ +#define COPY 1 /* copy input directly */ +#define GZIP 2 /* decompress a gzip stream */ + +/* internal gzip file state data structure */ +typedef struct { + /* exposed contents for gzgetc() macro */ + struct gzFile_s x; /* "x" for exposed */ + /* x.have: number of bytes available at x.next */ + /* x.next: next output data to deliver or write */ + /* x.pos: current position in uncompressed data */ + /* used for both reading and writing */ + int mode; /* see gzip modes above */ + int fd; /* file descriptor */ + char *path; /* path or fd for error messages */ + unsigned size; /* buffer size, zero if not allocated yet */ + unsigned want; /* requested buffer size, default is GZBUFSIZE */ + unsigned char *in; /* input buffer (double-sized when writing) */ + unsigned char *out; /* output buffer (double-sized when reading) */ + int direct; /* 0 if processing gzip, 1 if transparent */ + /* just for reading */ + int how; /* 0: get header, 1: copy, 2: decompress */ + z_off64_t start; /* where the gzip data started, for rewinding */ + int eof; /* true if end of input file reached */ + int past; /* true if read requested past end */ + /* just for writing */ + int level; /* compression level */ + int strategy; /* compression strategy */ + /* seek request */ + z_off64_t skip; /* amount to skip (already rewound if backwards) */ + int seek; /* true if seek request pending */ + /* error information */ + int err; /* error code */ + char *msg; /* error message */ + /* zlib inflate or deflate stream */ + z_stream strm; /* stream structure in-place (not a pointer) */ +} gz_state; +typedef gz_state FAR *gz_statep; + +/* shared functions */ +void ZLIB_INTERNAL gz_error OF((gz_statep, int, const char *)); +#if defined UNDER_CE +char ZLIB_INTERNAL *gz_strwinerror OF((DWORD error)); +#endif + +/* GT_OFF(x), where x is an unsigned value, is true if x > maximum z_off64_t + value -- needed when comparing unsigned to z_off64_t, which is signed + (possible z_off64_t types off_t, off64_t, and long are all signed) */ +#ifdef INT_MAX +# define GT_OFF(x) (sizeof(int) == sizeof(z_off64_t) && (x) > INT_MAX) +#else +unsigned ZLIB_INTERNAL gz_intmax OF((void)); +# define GT_OFF(x) (sizeof(int) == sizeof(z_off64_t) && (x) > gz_intmax()) +#endif diff --git a/PdbChecker/zlib/infback.c b/PdbChecker/zlib/infback.c new file mode 100644 index 0000000..59679ec --- /dev/null +++ b/PdbChecker/zlib/infback.c @@ -0,0 +1,640 @@ +/* infback.c -- inflate using a call-back interface + * Copyright (C) 1995-2016 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* + This code is largely copied from inflate.c. Normally either infback.o or + inflate.o would be linked into an application--not both. The interface + with inffast.c is retained so that optimized assembler-coded versions of + inflate_fast() can be used with either inflate.c or infback.c. + */ + +#include "zutil.h" +#include "inftrees.h" +#include "inflate.h" +#include "inffast.h" + +/* function prototypes */ +local void fixedtables OF((struct inflate_state FAR *state)); + +/* + strm provides memory allocation functions in zalloc and zfree, or + Z_NULL to use the library memory allocation functions. + + windowBits is in the range 8..15, and window is a user-supplied + window and output buffer that is 2**windowBits bytes. + */ +int ZEXPORT inflateBackInit_(strm, windowBits, window, version, stream_size) +z_streamp strm; +int windowBits; +unsigned char FAR *window; +const char *version; +int stream_size; +{ + struct inflate_state FAR *state; + + if (version == Z_NULL || version[0] != ZLIB_VERSION[0] || + stream_size != (int)(sizeof(z_stream))) + return Z_VERSION_ERROR; + if (strm == Z_NULL || window == Z_NULL || + windowBits < 8 || windowBits > 15) + return Z_STREAM_ERROR; + strm->msg = Z_NULL; /* in case we return an error */ + if (strm->zalloc == (alloc_func)0) { +#ifdef Z_SOLO + return Z_STREAM_ERROR; +#else + strm->zalloc = zcalloc; + strm->opaque = (voidpf)0; +#endif + } + if (strm->zfree == (free_func)0) +#ifdef Z_SOLO + return Z_STREAM_ERROR; +#else + strm->zfree = zcfree; +#endif + state = (struct inflate_state FAR *)ZALLOC(strm, 1, + sizeof(struct inflate_state)); + if (state == Z_NULL) return Z_MEM_ERROR; + Tracev((stderr, "inflate: allocated\n")); + strm->state = (struct internal_state FAR *)state; + state->dmax = 32768U; + state->wbits = (uInt)windowBits; + state->wsize = 1U << windowBits; + state->window = window; + state->wnext = 0; + state->whave = 0; + return Z_OK; +} + +/* + Return state with length and distance decoding tables and index sizes set to + fixed code decoding. Normally this returns fixed tables from inffixed.h. + If BUILDFIXED is defined, then instead this routine builds the tables the + first time it's called, and returns those tables the first time and + thereafter. This reduces the size of the code by about 2K bytes, in + exchange for a little execution time. However, BUILDFIXED should not be + used for threaded applications, since the rewriting of the tables and virgin + may not be thread-safe. + */ +local void fixedtables(state) +struct inflate_state FAR *state; +{ +#ifdef BUILDFIXED + static int virgin = 1; + static code *lenfix, *distfix; + static code fixed[544]; + + /* build fixed huffman tables if first call (may not be thread safe) */ + if (virgin) { + unsigned sym, bits; + static code *next; + + /* literal/length table */ + sym = 0; + while (sym < 144) state->lens[sym++] = 8; + while (sym < 256) state->lens[sym++] = 9; + while (sym < 280) state->lens[sym++] = 7; + while (sym < 288) state->lens[sym++] = 8; + next = fixed; + lenfix = next; + bits = 9; + inflate_table(LENS, state->lens, 288, &(next), &(bits), state->work); + + /* distance table */ + sym = 0; + while (sym < 32) state->lens[sym++] = 5; + distfix = next; + bits = 5; + inflate_table(DISTS, state->lens, 32, &(next), &(bits), state->work); + + /* do this just once */ + virgin = 0; + } +#else /* !BUILDFIXED */ +# include "inffixed.h" +#endif /* BUILDFIXED */ + state->lencode = lenfix; + state->lenbits = 9; + state->distcode = distfix; + state->distbits = 5; +} + +/* Macros for inflateBack(): */ + +/* Load returned state from inflate_fast() */ +#define LOAD() \ + do { \ + put = strm->next_out; \ + left = strm->avail_out; \ + next = strm->next_in; \ + have = strm->avail_in; \ + hold = state->hold; \ + bits = state->bits; \ + } while (0) + +/* Set state from registers for inflate_fast() */ +#define RESTORE() \ + do { \ + strm->next_out = put; \ + strm->avail_out = left; \ + strm->next_in = next; \ + strm->avail_in = have; \ + state->hold = hold; \ + state->bits = bits; \ + } while (0) + +/* Clear the input bit accumulator */ +#define INITBITS() \ + do { \ + hold = 0; \ + bits = 0; \ + } while (0) + +/* Assure that some input is available. If input is requested, but denied, + then return a Z_BUF_ERROR from inflateBack(). */ +#define PULL() \ + do { \ + if (have == 0) { \ + have = in(in_desc, &next); \ + if (have == 0) { \ + next = Z_NULL; \ + ret = Z_BUF_ERROR; \ + goto inf_leave; \ + } \ + } \ + } while (0) + +/* Get a byte of input into the bit accumulator, or return from inflateBack() + with an error if there is no input available. */ +#define PULLBYTE() \ + do { \ + PULL(); \ + have--; \ + hold += (unsigned long)(*next++) << bits; \ + bits += 8; \ + } while (0) + +/* Assure that there are at least n bits in the bit accumulator. If there is + not enough available input to do that, then return from inflateBack() with + an error. */ +#define NEEDBITS(n) \ + do { \ + while (bits < (unsigned)(n)) \ + PULLBYTE(); \ + } while (0) + +/* Return the low n bits of the bit accumulator (n < 16) */ +#define BITS(n) \ + ((unsigned)hold & ((1U << (n)) - 1)) + +/* Remove n bits from the bit accumulator */ +#define DROPBITS(n) \ + do { \ + hold >>= (n); \ + bits -= (unsigned)(n); \ + } while (0) + +/* Remove zero to seven bits as needed to go to a byte boundary */ +#define BYTEBITS() \ + do { \ + hold >>= bits & 7; \ + bits -= bits & 7; \ + } while (0) + +/* Assure that some output space is available, by writing out the window + if it's full. If the write fails, return from inflateBack() with a + Z_BUF_ERROR. */ +#define ROOM() \ + do { \ + if (left == 0) { \ + put = state->window; \ + left = state->wsize; \ + state->whave = left; \ + if (out(out_desc, put, left)) { \ + ret = Z_BUF_ERROR; \ + goto inf_leave; \ + } \ + } \ + } while (0) + +/* + strm provides the memory allocation functions and window buffer on input, + and provides information on the unused input on return. For Z_DATA_ERROR + returns, strm will also provide an error message. + + in() and out() are the call-back input and output functions. When + inflateBack() needs more input, it calls in(). When inflateBack() has + filled the window with output, or when it completes with data in the + window, it calls out() to write out the data. The application must not + change the provided input until in() is called again or inflateBack() + returns. The application must not change the window/output buffer until + inflateBack() returns. + + in() and out() are called with a descriptor parameter provided in the + inflateBack() call. This parameter can be a structure that provides the + information required to do the read or write, as well as accumulated + information on the input and output such as totals and check values. + + in() should return zero on failure. out() should return non-zero on + failure. If either in() or out() fails, than inflateBack() returns a + Z_BUF_ERROR. strm->next_in can be checked for Z_NULL to see whether it + was in() or out() that caused in the error. Otherwise, inflateBack() + returns Z_STREAM_END on success, Z_DATA_ERROR for an deflate format + error, or Z_MEM_ERROR if it could not allocate memory for the state. + inflateBack() can also return Z_STREAM_ERROR if the input parameters + are not correct, i.e. strm is Z_NULL or the state was not initialized. + */ +int ZEXPORT inflateBack(strm, in, in_desc, out, out_desc) +z_streamp strm; +in_func in; +void FAR *in_desc; +out_func out; +void FAR *out_desc; +{ + struct inflate_state FAR *state; + z_const unsigned char FAR *next; /* next input */ + unsigned char FAR *put; /* next output */ + unsigned have, left; /* available input and output */ + unsigned long hold; /* bit buffer */ + unsigned bits; /* bits in bit buffer */ + unsigned copy; /* number of stored or match bytes to copy */ + unsigned char FAR *from; /* where to copy match bytes from */ + code here; /* current decoding table entry */ + code last; /* parent table entry */ + unsigned len; /* length to copy for repeats, bits to drop */ + int ret; /* return code */ + static const unsigned short order[19] = /* permutation of code lengths */ + {16, 17, 18, 0, 8, 7, 9, 6, 10, 5, 11, 4, 12, 3, 13, 2, 14, 1, 15}; + + /* Check that the strm exists and that the state was initialized */ + if (strm == Z_NULL || strm->state == Z_NULL) + return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + + /* Reset the state */ + strm->msg = Z_NULL; + state->mode = TYPE; + state->last = 0; + state->whave = 0; + next = strm->next_in; + have = next != Z_NULL ? strm->avail_in : 0; + hold = 0; + bits = 0; + put = state->window; + left = state->wsize; + + /* Inflate until end of block marked as last */ + for (;;) + switch (state->mode) { + case TYPE: + /* determine and dispatch block type */ + if (state->last) { + BYTEBITS(); + state->mode = DONE; + break; + } + NEEDBITS(3); + state->last = BITS(1); + DROPBITS(1); + switch (BITS(2)) { + case 0: /* stored block */ + Tracev((stderr, "inflate: stored block%s\n", + state->last ? " (last)" : "")); + state->mode = STORED; + break; + case 1: /* fixed block */ + fixedtables(state); + Tracev((stderr, "inflate: fixed codes block%s\n", + state->last ? " (last)" : "")); + state->mode = LEN; /* decode codes */ + break; + case 2: /* dynamic block */ + Tracev((stderr, "inflate: dynamic codes block%s\n", + state->last ? " (last)" : "")); + state->mode = TABLE; + break; + case 3: + strm->msg = (char *)"invalid block type"; + state->mode = BAD; + } + DROPBITS(2); + break; + + case STORED: + /* get and verify stored block length */ + BYTEBITS(); /* go to byte boundary */ + NEEDBITS(32); + if ((hold & 0xffff) != ((hold >> 16) ^ 0xffff)) { + strm->msg = (char *)"invalid stored block lengths"; + state->mode = BAD; + break; + } + state->length = (unsigned)hold & 0xffff; + Tracev((stderr, "inflate: stored length %u\n", + state->length)); + INITBITS(); + + /* copy stored block from input to output */ + while (state->length != 0) { + copy = state->length; + PULL(); + ROOM(); + if (copy > have) copy = have; + if (copy > left) copy = left; + zmemcpy(put, next, copy); + have -= copy; + next += copy; + left -= copy; + put += copy; + state->length -= copy; + } + Tracev((stderr, "inflate: stored end\n")); + state->mode = TYPE; + break; + + case TABLE: + /* get dynamic table entries descriptor */ + NEEDBITS(14); + state->nlen = BITS(5) + 257; + DROPBITS(5); + state->ndist = BITS(5) + 1; + DROPBITS(5); + state->ncode = BITS(4) + 4; + DROPBITS(4); +#ifndef PKZIP_BUG_WORKAROUND + if (state->nlen > 286 || state->ndist > 30) { + strm->msg = (char *)"too many length or distance symbols"; + state->mode = BAD; + break; + } +#endif + Tracev((stderr, "inflate: table sizes ok\n")); + + /* get code length code lengths (not a typo) */ + state->have = 0; + while (state->have < state->ncode) { + NEEDBITS(3); + state->lens[order[state->have++]] = (unsigned short)BITS(3); + DROPBITS(3); + } + while (state->have < 19) + state->lens[order[state->have++]] = 0; + state->next = state->codes; + state->lencode = (code const FAR *)(state->next); + state->lenbits = 7; + ret = inflate_table(CODES, state->lens, 19, &(state->next), + &(state->lenbits), state->work); + if (ret) { + strm->msg = (char *)"invalid code lengths set"; + state->mode = BAD; + break; + } + Tracev((stderr, "inflate: code lengths ok\n")); + + /* get length and distance code code lengths */ + state->have = 0; + while (state->have < state->nlen + state->ndist) { + for (;;) { + here = state->lencode[BITS(state->lenbits)]; + if ((unsigned)(here.bits) <= bits) break; + PULLBYTE(); + } + if (here.val < 16) { + DROPBITS(here.bits); + state->lens[state->have++] = here.val; + } + else { + if (here.val == 16) { + NEEDBITS(here.bits + 2); + DROPBITS(here.bits); + if (state->have == 0) { + strm->msg = (char *)"invalid bit length repeat"; + state->mode = BAD; + break; + } + len = (unsigned)(state->lens[state->have - 1]); + copy = 3 + BITS(2); + DROPBITS(2); + } + else if (here.val == 17) { + NEEDBITS(here.bits + 3); + DROPBITS(here.bits); + len = 0; + copy = 3 + BITS(3); + DROPBITS(3); + } + else { + NEEDBITS(here.bits + 7); + DROPBITS(here.bits); + len = 0; + copy = 11 + BITS(7); + DROPBITS(7); + } + if (state->have + copy > state->nlen + state->ndist) { + strm->msg = (char *)"invalid bit length repeat"; + state->mode = BAD; + break; + } + while (copy--) + state->lens[state->have++] = (unsigned short)len; + } + } + + /* handle error breaks in while */ + if (state->mode == BAD) break; + + /* check for end-of-block code (better have one) */ + if (state->lens[256] == 0) { + strm->msg = (char *)"invalid code -- missing end-of-block"; + state->mode = BAD; + break; + } + + /* build code tables -- note: do not change the lenbits or distbits + values here (9 and 6) without reading the comments in inftrees.h + concerning the ENOUGH constants, which depend on those values */ + state->next = state->codes; + state->lencode = (code const FAR *)(state->next); + state->lenbits = 9; + ret = inflate_table(LENS, state->lens, state->nlen, &(state->next), + &(state->lenbits), state->work); + if (ret) { + strm->msg = (char *)"invalid literal/lengths set"; + state->mode = BAD; + break; + } + state->distcode = (code const FAR *)(state->next); + state->distbits = 6; + ret = inflate_table(DISTS, state->lens + state->nlen, state->ndist, + &(state->next), &(state->distbits), state->work); + if (ret) { + strm->msg = (char *)"invalid distances set"; + state->mode = BAD; + break; + } + Tracev((stderr, "inflate: codes ok\n")); + state->mode = LEN; + + case LEN: + /* use inflate_fast() if we have enough input and output */ + if (have >= 6 && left >= 258) { + RESTORE(); + if (state->whave < state->wsize) + state->whave = state->wsize - left; + inflate_fast(strm, state->wsize); + LOAD(); + break; + } + + /* get a literal, length, or end-of-block code */ + for (;;) { + here = state->lencode[BITS(state->lenbits)]; + if ((unsigned)(here.bits) <= bits) break; + PULLBYTE(); + } + if (here.op && (here.op & 0xf0) == 0) { + last = here; + for (;;) { + here = state->lencode[last.val + + (BITS(last.bits + last.op) >> last.bits)]; + if ((unsigned)(last.bits + here.bits) <= bits) break; + PULLBYTE(); + } + DROPBITS(last.bits); + } + DROPBITS(here.bits); + state->length = (unsigned)here.val; + + /* process literal */ + if (here.op == 0) { + Tracevv((stderr, here.val >= 0x20 && here.val < 0x7f ? + "inflate: literal '%c'\n" : + "inflate: literal 0x%02x\n", here.val)); + ROOM(); + *put++ = (unsigned char)(state->length); + left--; + state->mode = LEN; + break; + } + + /* process end of block */ + if (here.op & 32) { + Tracevv((stderr, "inflate: end of block\n")); + state->mode = TYPE; + break; + } + + /* invalid code */ + if (here.op & 64) { + strm->msg = (char *)"invalid literal/length code"; + state->mode = BAD; + break; + } + + /* length code -- get extra bits, if any */ + state->extra = (unsigned)(here.op) & 15; + if (state->extra != 0) { + NEEDBITS(state->extra); + state->length += BITS(state->extra); + DROPBITS(state->extra); + } + Tracevv((stderr, "inflate: length %u\n", state->length)); + + /* get distance code */ + for (;;) { + here = state->distcode[BITS(state->distbits)]; + if ((unsigned)(here.bits) <= bits) break; + PULLBYTE(); + } + if ((here.op & 0xf0) == 0) { + last = here; + for (;;) { + here = state->distcode[last.val + + (BITS(last.bits + last.op) >> last.bits)]; + if ((unsigned)(last.bits + here.bits) <= bits) break; + PULLBYTE(); + } + DROPBITS(last.bits); + } + DROPBITS(here.bits); + if (here.op & 64) { + strm->msg = (char *)"invalid distance code"; + state->mode = BAD; + break; + } + state->offset = (unsigned)here.val; + + /* get distance extra bits, if any */ + state->extra = (unsigned)(here.op) & 15; + if (state->extra != 0) { + NEEDBITS(state->extra); + state->offset += BITS(state->extra); + DROPBITS(state->extra); + } + if (state->offset > state->wsize - (state->whave < state->wsize ? + left : 0)) { + strm->msg = (char *)"invalid distance too far back"; + state->mode = BAD; + break; + } + Tracevv((stderr, "inflate: distance %u\n", state->offset)); + + /* copy match from window to output */ + do { + ROOM(); + copy = state->wsize - state->offset; + if (copy < left) { + from = put + copy; + copy = left - copy; + } + else { + from = put - state->offset; + copy = left; + } + if (copy > state->length) copy = state->length; + state->length -= copy; + left -= copy; + do { + *put++ = *from++; + } while (--copy); + } while (state->length != 0); + break; + + case DONE: + /* inflate stream terminated properly -- write leftover output */ + ret = Z_STREAM_END; + if (left < state->wsize) { + if (out(out_desc, state->window, state->wsize - left)) + ret = Z_BUF_ERROR; + } + goto inf_leave; + + case BAD: + ret = Z_DATA_ERROR; + goto inf_leave; + + default: /* can't happen, but makes compilers happy */ + ret = Z_STREAM_ERROR; + goto inf_leave; + } + + /* Return unused input */ + inf_leave: + strm->next_in = next; + strm->avail_in = have; + return ret; +} + +int ZEXPORT inflateBackEnd(strm) +z_streamp strm; +{ + if (strm == Z_NULL || strm->state == Z_NULL || strm->zfree == (free_func)0) + return Z_STREAM_ERROR; + ZFREE(strm, strm->state); + strm->state = Z_NULL; + Tracev((stderr, "inflate: end\n")); + return Z_OK; +} diff --git a/PdbChecker/zlib/inffast.c b/PdbChecker/zlib/inffast.c new file mode 100644 index 0000000..0dbd1db --- /dev/null +++ b/PdbChecker/zlib/inffast.c @@ -0,0 +1,323 @@ +/* inffast.c -- fast decoding + * Copyright (C) 1995-2017 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +#include "zutil.h" +#include "inftrees.h" +#include "inflate.h" +#include "inffast.h" + +#ifdef ASMINF +# pragma message("Assembler code may have bugs -- use at your own risk") +#else + +/* + Decode literal, length, and distance codes and write out the resulting + literal and match bytes until either not enough input or output is + available, an end-of-block is encountered, or a data error is encountered. + When large enough input and output buffers are supplied to inflate(), for + example, a 16K input buffer and a 64K output buffer, more than 95% of the + inflate execution time is spent in this routine. + + Entry assumptions: + + state->mode == LEN + strm->avail_in >= 6 + strm->avail_out >= 258 + start >= strm->avail_out + state->bits < 8 + + On return, state->mode is one of: + + LEN -- ran out of enough output space or enough available input + TYPE -- reached end of block code, inflate() to interpret next block + BAD -- error in block data + + Notes: + + - The maximum input bits used by a length/distance pair is 15 bits for the + length code, 5 bits for the length extra, 15 bits for the distance code, + and 13 bits for the distance extra. This totals 48 bits, or six bytes. + Therefore if strm->avail_in >= 6, then there is enough input to avoid + checking for available input while decoding. + + - The maximum bytes that a single length/distance pair can output is 258 + bytes, which is the maximum length that can be coded. inflate_fast() + requires strm->avail_out >= 258 for each loop to avoid checking for + output space. + */ +void ZLIB_INTERNAL inflate_fast(strm, start) +z_streamp strm; +unsigned start; /* inflate()'s starting value for strm->avail_out */ +{ + struct inflate_state FAR *state; + z_const unsigned char FAR *in; /* local strm->next_in */ + z_const unsigned char FAR *last; /* have enough input while in < last */ + unsigned char FAR *out; /* local strm->next_out */ + unsigned char FAR *beg; /* inflate()'s initial strm->next_out */ + unsigned char FAR *end; /* while out < end, enough space available */ +#ifdef INFLATE_STRICT + unsigned dmax; /* maximum distance from zlib header */ +#endif + unsigned wsize; /* window size or zero if not using window */ + unsigned whave; /* valid bytes in the window */ + unsigned wnext; /* window write index */ + unsigned char FAR *window; /* allocated sliding window, if wsize != 0 */ + unsigned long hold; /* local strm->hold */ + unsigned bits; /* local strm->bits */ + code const FAR *lcode; /* local strm->lencode */ + code const FAR *dcode; /* local strm->distcode */ + unsigned lmask; /* mask for first level of length codes */ + unsigned dmask; /* mask for first level of distance codes */ + code here; /* retrieved table entry */ + unsigned op; /* code bits, operation, extra bits, or */ + /* window position, window bytes to copy */ + unsigned len; /* match length, unused bytes */ + unsigned dist; /* match distance */ + unsigned char FAR *from; /* where to copy match from */ + + /* copy state to local variables */ + state = (struct inflate_state FAR *)strm->state; + in = strm->next_in; + last = in + (strm->avail_in - 5); + out = strm->next_out; + beg = out - (start - strm->avail_out); + end = out + (strm->avail_out - 257); +#ifdef INFLATE_STRICT + dmax = state->dmax; +#endif + wsize = state->wsize; + whave = state->whave; + wnext = state->wnext; + window = state->window; + hold = state->hold; + bits = state->bits; + lcode = state->lencode; + dcode = state->distcode; + lmask = (1U << state->lenbits) - 1; + dmask = (1U << state->distbits) - 1; + + /* decode literals and length/distances until end-of-block or not enough + input data or output space */ + do { + if (bits < 15) { + hold += (unsigned long)(*in++) << bits; + bits += 8; + hold += (unsigned long)(*in++) << bits; + bits += 8; + } + here = lcode[hold & lmask]; + dolen: + op = (unsigned)(here.bits); + hold >>= op; + bits -= op; + op = (unsigned)(here.op); + if (op == 0) { /* literal */ + Tracevv((stderr, here.val >= 0x20 && here.val < 0x7f ? + "inflate: literal '%c'\n" : + "inflate: literal 0x%02x\n", here.val)); + *out++ = (unsigned char)(here.val); + } + else if (op & 16) { /* length base */ + len = (unsigned)(here.val); + op &= 15; /* number of extra bits */ + if (op) { + if (bits < op) { + hold += (unsigned long)(*in++) << bits; + bits += 8; + } + len += (unsigned)hold & ((1U << op) - 1); + hold >>= op; + bits -= op; + } + Tracevv((stderr, "inflate: length %u\n", len)); + if (bits < 15) { + hold += (unsigned long)(*in++) << bits; + bits += 8; + hold += (unsigned long)(*in++) << bits; + bits += 8; + } + here = dcode[hold & dmask]; + dodist: + op = (unsigned)(here.bits); + hold >>= op; + bits -= op; + op = (unsigned)(here.op); + if (op & 16) { /* distance base */ + dist = (unsigned)(here.val); + op &= 15; /* number of extra bits */ + if (bits < op) { + hold += (unsigned long)(*in++) << bits; + bits += 8; + if (bits < op) { + hold += (unsigned long)(*in++) << bits; + bits += 8; + } + } + dist += (unsigned)hold & ((1U << op) - 1); +#ifdef INFLATE_STRICT + if (dist > dmax) { + strm->msg = (char *)"invalid distance too far back"; + state->mode = BAD; + break; + } +#endif + hold >>= op; + bits -= op; + Tracevv((stderr, "inflate: distance %u\n", dist)); + op = (unsigned)(out - beg); /* max distance in output */ + if (dist > op) { /* see if copy from window */ + op = dist - op; /* distance back in window */ + if (op > whave) { + if (state->sane) { + strm->msg = + (char *)"invalid distance too far back"; + state->mode = BAD; + break; + } +#ifdef INFLATE_ALLOW_INVALID_DISTANCE_TOOFAR_ARRR + if (len <= op - whave) { + do { + *out++ = 0; + } while (--len); + continue; + } + len -= op - whave; + do { + *out++ = 0; + } while (--op > whave); + if (op == 0) { + from = out - dist; + do { + *out++ = *from++; + } while (--len); + continue; + } +#endif + } + from = window; + if (wnext == 0) { /* very common case */ + from += wsize - op; + if (op < len) { /* some from window */ + len -= op; + do { + *out++ = *from++; + } while (--op); + from = out - dist; /* rest from output */ + } + } + else if (wnext < op) { /* wrap around window */ + from += wsize + wnext - op; + op -= wnext; + if (op < len) { /* some from end of window */ + len -= op; + do { + *out++ = *from++; + } while (--op); + from = window; + if (wnext < len) { /* some from start of window */ + op = wnext; + len -= op; + do { + *out++ = *from++; + } while (--op); + from = out - dist; /* rest from output */ + } + } + } + else { /* contiguous in window */ + from += wnext - op; + if (op < len) { /* some from window */ + len -= op; + do { + *out++ = *from++; + } while (--op); + from = out - dist; /* rest from output */ + } + } + while (len > 2) { + *out++ = *from++; + *out++ = *from++; + *out++ = *from++; + len -= 3; + } + if (len) { + *out++ = *from++; + if (len > 1) + *out++ = *from++; + } + } + else { + from = out - dist; /* copy direct from output */ + do { /* minimum length is three */ + *out++ = *from++; + *out++ = *from++; + *out++ = *from++; + len -= 3; + } while (len > 2); + if (len) { + *out++ = *from++; + if (len > 1) + *out++ = *from++; + } + } + } + else if ((op & 64) == 0) { /* 2nd level distance code */ + here = dcode[here.val + (hold & ((1U << op) - 1))]; + goto dodist; + } + else { + strm->msg = (char *)"invalid distance code"; + state->mode = BAD; + break; + } + } + else if ((op & 64) == 0) { /* 2nd level length code */ + here = lcode[here.val + (hold & ((1U << op) - 1))]; + goto dolen; + } + else if (op & 32) { /* end-of-block */ + Tracevv((stderr, "inflate: end of block\n")); + state->mode = TYPE; + break; + } + else { + strm->msg = (char *)"invalid literal/length code"; + state->mode = BAD; + break; + } + } while (in < last && out < end); + + /* return unused bytes (on entry, bits < 8, so in won't go too far back) */ + len = bits >> 3; + in -= len; + bits -= len << 3; + hold &= (1U << bits) - 1; + + /* update state and return */ + strm->next_in = in; + strm->next_out = out; + strm->avail_in = (unsigned)(in < last ? 5 + (last - in) : 5 - (in - last)); + strm->avail_out = (unsigned)(out < end ? + 257 + (end - out) : 257 - (out - end)); + state->hold = hold; + state->bits = bits; + return; +} + +/* + inflate_fast() speedups that turned out slower (on a PowerPC G3 750CXe): + - Using bit fields for code structure + - Different op definition to avoid & for extra bits (do & for table bits) + - Three separate decoding do-loops for direct, window, and wnext == 0 + - Special case for distance > 1 copies to do overlapped load and store copy + - Explicit branch predictions (based on measured branch probabilities) + - Deferring match copy and interspersed it with decoding subsequent codes + - Swapping literal/length else + - Swapping window/direct else + - Larger unrolled copy loops (three is about right) + - Moving len -= 3 statement into middle of loop + */ + +#endif /* !ASMINF */ diff --git a/PdbChecker/zlib/inffast.h b/PdbChecker/zlib/inffast.h new file mode 100644 index 0000000..e5c1aa4 --- /dev/null +++ b/PdbChecker/zlib/inffast.h @@ -0,0 +1,11 @@ +/* inffast.h -- header to use inffast.c + * Copyright (C) 1995-2003, 2010 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* WARNING: this file should *not* be used by applications. It is + part of the implementation of the compression library and is + subject to change. Applications should only use zlib.h. + */ + +void ZLIB_INTERNAL inflate_fast OF((z_streamp strm, unsigned start)); diff --git a/PdbChecker/zlib/inffixed.h b/PdbChecker/zlib/inffixed.h new file mode 100644 index 0000000..d628327 --- /dev/null +++ b/PdbChecker/zlib/inffixed.h @@ -0,0 +1,94 @@ + /* inffixed.h -- table for decoding fixed codes + * Generated automatically by makefixed(). + */ + + /* WARNING: this file should *not* be used by applications. + It is part of the implementation of this library and is + subject to change. Applications should only use zlib.h. + */ + + static const code lenfix[512] = { + {96,7,0},{0,8,80},{0,8,16},{20,8,115},{18,7,31},{0,8,112},{0,8,48}, + {0,9,192},{16,7,10},{0,8,96},{0,8,32},{0,9,160},{0,8,0},{0,8,128}, + {0,8,64},{0,9,224},{16,7,6},{0,8,88},{0,8,24},{0,9,144},{19,7,59}, + {0,8,120},{0,8,56},{0,9,208},{17,7,17},{0,8,104},{0,8,40},{0,9,176}, + {0,8,8},{0,8,136},{0,8,72},{0,9,240},{16,7,4},{0,8,84},{0,8,20}, + {21,8,227},{19,7,43},{0,8,116},{0,8,52},{0,9,200},{17,7,13},{0,8,100}, + {0,8,36},{0,9,168},{0,8,4},{0,8,132},{0,8,68},{0,9,232},{16,7,8}, + {0,8,92},{0,8,28},{0,9,152},{20,7,83},{0,8,124},{0,8,60},{0,9,216}, + {18,7,23},{0,8,108},{0,8,44},{0,9,184},{0,8,12},{0,8,140},{0,8,76}, + {0,9,248},{16,7,3},{0,8,82},{0,8,18},{21,8,163},{19,7,35},{0,8,114}, + {0,8,50},{0,9,196},{17,7,11},{0,8,98},{0,8,34},{0,9,164},{0,8,2}, + {0,8,130},{0,8,66},{0,9,228},{16,7,7},{0,8,90},{0,8,26},{0,9,148}, + {20,7,67},{0,8,122},{0,8,58},{0,9,212},{18,7,19},{0,8,106},{0,8,42}, + {0,9,180},{0,8,10},{0,8,138},{0,8,74},{0,9,244},{16,7,5},{0,8,86}, + {0,8,22},{64,8,0},{19,7,51},{0,8,118},{0,8,54},{0,9,204},{17,7,15}, + {0,8,102},{0,8,38},{0,9,172},{0,8,6},{0,8,134},{0,8,70},{0,9,236}, + {16,7,9},{0,8,94},{0,8,30},{0,9,156},{20,7,99},{0,8,126},{0,8,62}, + {0,9,220},{18,7,27},{0,8,110},{0,8,46},{0,9,188},{0,8,14},{0,8,142}, + {0,8,78},{0,9,252},{96,7,0},{0,8,81},{0,8,17},{21,8,131},{18,7,31}, + {0,8,113},{0,8,49},{0,9,194},{16,7,10},{0,8,97},{0,8,33},{0,9,162}, + {0,8,1},{0,8,129},{0,8,65},{0,9,226},{16,7,6},{0,8,89},{0,8,25}, + {0,9,146},{19,7,59},{0,8,121},{0,8,57},{0,9,210},{17,7,17},{0,8,105}, + {0,8,41},{0,9,178},{0,8,9},{0,8,137},{0,8,73},{0,9,242},{16,7,4}, + {0,8,85},{0,8,21},{16,8,258},{19,7,43},{0,8,117},{0,8,53},{0,9,202}, + {17,7,13},{0,8,101},{0,8,37},{0,9,170},{0,8,5},{0,8,133},{0,8,69}, + {0,9,234},{16,7,8},{0,8,93},{0,8,29},{0,9,154},{20,7,83},{0,8,125}, + {0,8,61},{0,9,218},{18,7,23},{0,8,109},{0,8,45},{0,9,186},{0,8,13}, + {0,8,141},{0,8,77},{0,9,250},{16,7,3},{0,8,83},{0,8,19},{21,8,195}, + {19,7,35},{0,8,115},{0,8,51},{0,9,198},{17,7,11},{0,8,99},{0,8,35}, + {0,9,166},{0,8,3},{0,8,131},{0,8,67},{0,9,230},{16,7,7},{0,8,91}, + {0,8,27},{0,9,150},{20,7,67},{0,8,123},{0,8,59},{0,9,214},{18,7,19}, + {0,8,107},{0,8,43},{0,9,182},{0,8,11},{0,8,139},{0,8,75},{0,9,246}, + {16,7,5},{0,8,87},{0,8,23},{64,8,0},{19,7,51},{0,8,119},{0,8,55}, + {0,9,206},{17,7,15},{0,8,103},{0,8,39},{0,9,174},{0,8,7},{0,8,135}, + {0,8,71},{0,9,238},{16,7,9},{0,8,95},{0,8,31},{0,9,158},{20,7,99}, + {0,8,127},{0,8,63},{0,9,222},{18,7,27},{0,8,111},{0,8,47},{0,9,190}, + {0,8,15},{0,8,143},{0,8,79},{0,9,254},{96,7,0},{0,8,80},{0,8,16}, + {20,8,115},{18,7,31},{0,8,112},{0,8,48},{0,9,193},{16,7,10},{0,8,96}, + {0,8,32},{0,9,161},{0,8,0},{0,8,128},{0,8,64},{0,9,225},{16,7,6}, + {0,8,88},{0,8,24},{0,9,145},{19,7,59},{0,8,120},{0,8,56},{0,9,209}, + {17,7,17},{0,8,104},{0,8,40},{0,9,177},{0,8,8},{0,8,136},{0,8,72}, + {0,9,241},{16,7,4},{0,8,84},{0,8,20},{21,8,227},{19,7,43},{0,8,116}, + {0,8,52},{0,9,201},{17,7,13},{0,8,100},{0,8,36},{0,9,169},{0,8,4}, + {0,8,132},{0,8,68},{0,9,233},{16,7,8},{0,8,92},{0,8,28},{0,9,153}, + {20,7,83},{0,8,124},{0,8,60},{0,9,217},{18,7,23},{0,8,108},{0,8,44}, + {0,9,185},{0,8,12},{0,8,140},{0,8,76},{0,9,249},{16,7,3},{0,8,82}, + {0,8,18},{21,8,163},{19,7,35},{0,8,114},{0,8,50},{0,9,197},{17,7,11}, + {0,8,98},{0,8,34},{0,9,165},{0,8,2},{0,8,130},{0,8,66},{0,9,229}, + {16,7,7},{0,8,90},{0,8,26},{0,9,149},{20,7,67},{0,8,122},{0,8,58}, + {0,9,213},{18,7,19},{0,8,106},{0,8,42},{0,9,181},{0,8,10},{0,8,138}, + {0,8,74},{0,9,245},{16,7,5},{0,8,86},{0,8,22},{64,8,0},{19,7,51}, + {0,8,118},{0,8,54},{0,9,205},{17,7,15},{0,8,102},{0,8,38},{0,9,173}, + {0,8,6},{0,8,134},{0,8,70},{0,9,237},{16,7,9},{0,8,94},{0,8,30}, + {0,9,157},{20,7,99},{0,8,126},{0,8,62},{0,9,221},{18,7,27},{0,8,110}, + {0,8,46},{0,9,189},{0,8,14},{0,8,142},{0,8,78},{0,9,253},{96,7,0}, + {0,8,81},{0,8,17},{21,8,131},{18,7,31},{0,8,113},{0,8,49},{0,9,195}, + {16,7,10},{0,8,97},{0,8,33},{0,9,163},{0,8,1},{0,8,129},{0,8,65}, + {0,9,227},{16,7,6},{0,8,89},{0,8,25},{0,9,147},{19,7,59},{0,8,121}, + {0,8,57},{0,9,211},{17,7,17},{0,8,105},{0,8,41},{0,9,179},{0,8,9}, + {0,8,137},{0,8,73},{0,9,243},{16,7,4},{0,8,85},{0,8,21},{16,8,258}, + {19,7,43},{0,8,117},{0,8,53},{0,9,203},{17,7,13},{0,8,101},{0,8,37}, + {0,9,171},{0,8,5},{0,8,133},{0,8,69},{0,9,235},{16,7,8},{0,8,93}, + {0,8,29},{0,9,155},{20,7,83},{0,8,125},{0,8,61},{0,9,219},{18,7,23}, + {0,8,109},{0,8,45},{0,9,187},{0,8,13},{0,8,141},{0,8,77},{0,9,251}, + {16,7,3},{0,8,83},{0,8,19},{21,8,195},{19,7,35},{0,8,115},{0,8,51}, + {0,9,199},{17,7,11},{0,8,99},{0,8,35},{0,9,167},{0,8,3},{0,8,131}, + {0,8,67},{0,9,231},{16,7,7},{0,8,91},{0,8,27},{0,9,151},{20,7,67}, + {0,8,123},{0,8,59},{0,9,215},{18,7,19},{0,8,107},{0,8,43},{0,9,183}, + {0,8,11},{0,8,139},{0,8,75},{0,9,247},{16,7,5},{0,8,87},{0,8,23}, + {64,8,0},{19,7,51},{0,8,119},{0,8,55},{0,9,207},{17,7,15},{0,8,103}, + {0,8,39},{0,9,175},{0,8,7},{0,8,135},{0,8,71},{0,9,239},{16,7,9}, + {0,8,95},{0,8,31},{0,9,159},{20,7,99},{0,8,127},{0,8,63},{0,9,223}, + {18,7,27},{0,8,111},{0,8,47},{0,9,191},{0,8,15},{0,8,143},{0,8,79}, + {0,9,255} + }; + + static const code distfix[32] = { + {16,5,1},{23,5,257},{19,5,17},{27,5,4097},{17,5,5},{25,5,1025}, + {21,5,65},{29,5,16385},{16,5,3},{24,5,513},{20,5,33},{28,5,8193}, + {18,5,9},{26,5,2049},{22,5,129},{64,5,0},{16,5,2},{23,5,385}, + {19,5,25},{27,5,6145},{17,5,7},{25,5,1537},{21,5,97},{29,5,24577}, + {16,5,4},{24,5,769},{20,5,49},{28,5,12289},{18,5,13},{26,5,3073}, + {22,5,193},{64,5,0} + }; diff --git a/PdbChecker/zlib/inflate.c b/PdbChecker/zlib/inflate.c new file mode 100644 index 0000000..ac333e8 --- /dev/null +++ b/PdbChecker/zlib/inflate.c @@ -0,0 +1,1561 @@ +/* inflate.c -- zlib decompression + * Copyright (C) 1995-2016 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* + * Change history: + * + * 1.2.beta0 24 Nov 2002 + * - First version -- complete rewrite of inflate to simplify code, avoid + * creation of window when not needed, minimize use of window when it is + * needed, make inffast.c even faster, implement gzip decoding, and to + * improve code readability and style over the previous zlib inflate code + * + * 1.2.beta1 25 Nov 2002 + * - Use pointers for available input and output checking in inffast.c + * - Remove input and output counters in inffast.c + * - Change inffast.c entry and loop from avail_in >= 7 to >= 6 + * - Remove unnecessary second byte pull from length extra in inffast.c + * - Unroll direct copy to three copies per loop in inffast.c + * + * 1.2.beta2 4 Dec 2002 + * - Change external routine names to reduce potential conflicts + * - Correct filename to inffixed.h for fixed tables in inflate.c + * - Make hbuf[] unsigned char to match parameter type in inflate.c + * - Change strm->next_out[-state->offset] to *(strm->next_out - state->offset) + * to avoid negation problem on Alphas (64 bit) in inflate.c + * + * 1.2.beta3 22 Dec 2002 + * - Add comments on state->bits assertion in inffast.c + * - Add comments on op field in inftrees.h + * - Fix bug in reuse of allocated window after inflateReset() + * - Remove bit fields--back to byte structure for speed + * - Remove distance extra == 0 check in inflate_fast()--only helps for lengths + * - Change post-increments to pre-increments in inflate_fast(), PPC biased? + * - Add compile time option, POSTINC, to use post-increments instead (Intel?) + * - Make MATCH copy in inflate() much faster for when inflate_fast() not used + * - Use local copies of stream next and avail values, as well as local bit + * buffer and bit count in inflate()--for speed when inflate_fast() not used + * + * 1.2.beta4 1 Jan 2003 + * - Split ptr - 257 statements in inflate_table() to avoid compiler warnings + * - Move a comment on output buffer sizes from inffast.c to inflate.c + * - Add comments in inffast.c to introduce the inflate_fast() routine + * - Rearrange window copies in inflate_fast() for speed and simplification + * - Unroll last copy for window match in inflate_fast() + * - Use local copies of window variables in inflate_fast() for speed + * - Pull out common wnext == 0 case for speed in inflate_fast() + * - Make op and len in inflate_fast() unsigned for consistency + * - Add FAR to lcode and dcode declarations in inflate_fast() + * - Simplified bad distance check in inflate_fast() + * - Added inflateBackInit(), inflateBack(), and inflateBackEnd() in new + * source file infback.c to provide a call-back interface to inflate for + * programs like gzip and unzip -- uses window as output buffer to avoid + * window copying + * + * 1.2.beta5 1 Jan 2003 + * - Improved inflateBack() interface to allow the caller to provide initial + * input in strm. + * - Fixed stored blocks bug in inflateBack() + * + * 1.2.beta6 4 Jan 2003 + * - Added comments in inffast.c on effectiveness of POSTINC + * - Typecasting all around to reduce compiler warnings + * - Changed loops from while (1) or do {} while (1) to for (;;), again to + * make compilers happy + * - Changed type of window in inflateBackInit() to unsigned char * + * + * 1.2.beta7 27 Jan 2003 + * - Changed many types to unsigned or unsigned short to avoid warnings + * - Added inflateCopy() function + * + * 1.2.0 9 Mar 2003 + * - Changed inflateBack() interface to provide separate opaque descriptors + * for the in() and out() functions + * - Changed inflateBack() argument and in_func typedef to swap the length + * and buffer address return values for the input function + * - Check next_in and next_out for Z_NULL on entry to inflate() + * + * The history for versions after 1.2.0 are in ChangeLog in zlib distribution. + */ + +#include "zutil.h" +#include "inftrees.h" +#include "inflate.h" +#include "inffast.h" + +#ifdef MAKEFIXED +# ifndef BUILDFIXED +# define BUILDFIXED +# endif +#endif + +/* function prototypes */ +local int inflateStateCheck OF((z_streamp strm)); +local void fixedtables OF((struct inflate_state FAR *state)); +local int updatewindow OF((z_streamp strm, const unsigned char FAR *end, + unsigned copy)); +#ifdef BUILDFIXED + void makefixed OF((void)); +#endif +local unsigned syncsearch OF((unsigned FAR *have, const unsigned char FAR *buf, + unsigned len)); + +local int inflateStateCheck(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + if (strm == Z_NULL || + strm->zalloc == (alloc_func)0 || strm->zfree == (free_func)0) + return 1; + state = (struct inflate_state FAR *)strm->state; + if (state == Z_NULL || state->strm != strm || + state->mode < HEAD || state->mode > SYNC) + return 1; + return 0; +} + +int ZEXPORT inflateResetKeep(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + strm->total_in = strm->total_out = state->total = 0; + strm->msg = Z_NULL; + if (state->wrap) /* to support ill-conceived Java test suite */ + strm->adler = state->wrap & 1; + state->mode = HEAD; + state->last = 0; + state->havedict = 0; + state->dmax = 32768U; + state->head = Z_NULL; + state->hold = 0; + state->bits = 0; + state->lencode = state->distcode = state->next = state->codes; + state->sane = 1; + state->back = -1; + Tracev((stderr, "inflate: reset\n")); + return Z_OK; +} + +int ZEXPORT inflateReset(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + state->wsize = 0; + state->whave = 0; + state->wnext = 0; + return inflateResetKeep(strm); +} + +int ZEXPORT inflateReset2(strm, windowBits) +z_streamp strm; +int windowBits; +{ + int wrap; + struct inflate_state FAR *state; + + /* get the state */ + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + + /* extract wrap request from windowBits parameter */ + if (windowBits < 0) { + wrap = 0; + windowBits = -windowBits; + } + else { + wrap = (windowBits >> 4) + 5; +#ifdef GUNZIP + if (windowBits < 48) + windowBits &= 15; +#endif + } + + /* set number of window bits, free window if different */ + if (windowBits && (windowBits < 8 || windowBits > 15)) + return Z_STREAM_ERROR; + if (state->window != Z_NULL && state->wbits != (unsigned)windowBits) { + ZFREE(strm, state->window); + state->window = Z_NULL; + } + + /* update state and reset the rest of it */ + state->wrap = wrap; + state->wbits = (unsigned)windowBits; + return inflateReset(strm); +} + +int ZEXPORT inflateInit2_(strm, windowBits, version, stream_size) +z_streamp strm; +int windowBits; +const char *version; +int stream_size; +{ + int ret; + struct inflate_state FAR *state; + + if (version == Z_NULL || version[0] != ZLIB_VERSION[0] || + stream_size != (int)(sizeof(z_stream))) + return Z_VERSION_ERROR; + if (strm == Z_NULL) return Z_STREAM_ERROR; + strm->msg = Z_NULL; /* in case we return an error */ + if (strm->zalloc == (alloc_func)0) { +#ifdef Z_SOLO + return Z_STREAM_ERROR; +#else + strm->zalloc = zcalloc; + strm->opaque = (voidpf)0; +#endif + } + if (strm->zfree == (free_func)0) +#ifdef Z_SOLO + return Z_STREAM_ERROR; +#else + strm->zfree = zcfree; +#endif + state = (struct inflate_state FAR *) + ZALLOC(strm, 1, sizeof(struct inflate_state)); + if (state == Z_NULL) return Z_MEM_ERROR; + Tracev((stderr, "inflate: allocated\n")); + strm->state = (struct internal_state FAR *)state; + state->strm = strm; + state->window = Z_NULL; + state->mode = HEAD; /* to pass state test in inflateReset2() */ + ret = inflateReset2(strm, windowBits); + if (ret != Z_OK) { + ZFREE(strm, state); + strm->state = Z_NULL; + } + return ret; +} + +int ZEXPORT inflateInit_(strm, version, stream_size) +z_streamp strm; +const char *version; +int stream_size; +{ + return inflateInit2_(strm, DEF_WBITS, version, stream_size); +} + +int ZEXPORT inflatePrime(strm, bits, value) +z_streamp strm; +int bits; +int value; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + if (bits < 0) { + state->hold = 0; + state->bits = 0; + return Z_OK; + } + if (bits > 16 || state->bits + (uInt)bits > 32) return Z_STREAM_ERROR; + value &= (1L << bits) - 1; + state->hold += (unsigned)value << state->bits; + state->bits += (uInt)bits; + return Z_OK; +} + +/* + Return state with length and distance decoding tables and index sizes set to + fixed code decoding. Normally this returns fixed tables from inffixed.h. + If BUILDFIXED is defined, then instead this routine builds the tables the + first time it's called, and returns those tables the first time and + thereafter. This reduces the size of the code by about 2K bytes, in + exchange for a little execution time. However, BUILDFIXED should not be + used for threaded applications, since the rewriting of the tables and virgin + may not be thread-safe. + */ +local void fixedtables(state) +struct inflate_state FAR *state; +{ +#ifdef BUILDFIXED + static int virgin = 1; + static code *lenfix, *distfix; + static code fixed[544]; + + /* build fixed huffman tables if first call (may not be thread safe) */ + if (virgin) { + unsigned sym, bits; + static code *next; + + /* literal/length table */ + sym = 0; + while (sym < 144) state->lens[sym++] = 8; + while (sym < 256) state->lens[sym++] = 9; + while (sym < 280) state->lens[sym++] = 7; + while (sym < 288) state->lens[sym++] = 8; + next = fixed; + lenfix = next; + bits = 9; + inflate_table(LENS, state->lens, 288, &(next), &(bits), state->work); + + /* distance table */ + sym = 0; + while (sym < 32) state->lens[sym++] = 5; + distfix = next; + bits = 5; + inflate_table(DISTS, state->lens, 32, &(next), &(bits), state->work); + + /* do this just once */ + virgin = 0; + } +#else /* !BUILDFIXED */ +# include "inffixed.h" +#endif /* BUILDFIXED */ + state->lencode = lenfix; + state->lenbits = 9; + state->distcode = distfix; + state->distbits = 5; +} + +#ifdef MAKEFIXED +#include + +/* + Write out the inffixed.h that is #include'd above. Defining MAKEFIXED also + defines BUILDFIXED, so the tables are built on the fly. makefixed() writes + those tables to stdout, which would be piped to inffixed.h. A small program + can simply call makefixed to do this: + + void makefixed(void); + + int main(void) + { + makefixed(); + return 0; + } + + Then that can be linked with zlib built with MAKEFIXED defined and run: + + a.out > inffixed.h + */ +void makefixed() +{ + unsigned low, size; + struct inflate_state state; + + fixedtables(&state); + puts(" /* inffixed.h -- table for decoding fixed codes"); + puts(" * Generated automatically by makefixed()."); + puts(" */"); + puts(""); + puts(" /* WARNING: this file should *not* be used by applications."); + puts(" It is part of the implementation of this library and is"); + puts(" subject to change. Applications should only use zlib.h."); + puts(" */"); + puts(""); + size = 1U << 9; + printf(" static const code lenfix[%u] = {", size); + low = 0; + for (;;) { + if ((low % 7) == 0) printf("\n "); + printf("{%u,%u,%d}", (low & 127) == 99 ? 64 : state.lencode[low].op, + state.lencode[low].bits, state.lencode[low].val); + if (++low == size) break; + putchar(','); + } + puts("\n };"); + size = 1U << 5; + printf("\n static const code distfix[%u] = {", size); + low = 0; + for (;;) { + if ((low % 6) == 0) printf("\n "); + printf("{%u,%u,%d}", state.distcode[low].op, state.distcode[low].bits, + state.distcode[low].val); + if (++low == size) break; + putchar(','); + } + puts("\n };"); +} +#endif /* MAKEFIXED */ + +/* + Update the window with the last wsize (normally 32K) bytes written before + returning. If window does not exist yet, create it. This is only called + when a window is already in use, or when output has been written during this + inflate call, but the end of the deflate stream has not been reached yet. + It is also called to create a window for dictionary data when a dictionary + is loaded. + + Providing output buffers larger than 32K to inflate() should provide a speed + advantage, since only the last 32K of output is copied to the sliding window + upon return from inflate(), and since all distances after the first 32K of + output will fall in the output data, making match copies simpler and faster. + The advantage may be dependent on the size of the processor's data caches. + */ +local int updatewindow(strm, end, copy) +z_streamp strm; +const Bytef *end; +unsigned copy; +{ + struct inflate_state FAR *state; + unsigned dist; + + state = (struct inflate_state FAR *)strm->state; + + /* if it hasn't been done already, allocate space for the window */ + if (state->window == Z_NULL) { + state->window = (unsigned char FAR *) + ZALLOC(strm, 1U << state->wbits, + sizeof(unsigned char)); + if (state->window == Z_NULL) return 1; + } + + /* if window not in use yet, initialize */ + if (state->wsize == 0) { + state->wsize = 1U << state->wbits; + state->wnext = 0; + state->whave = 0; + } + + /* copy state->wsize or less output bytes into the circular window */ + if (copy >= state->wsize) { + zmemcpy(state->window, end - state->wsize, state->wsize); + state->wnext = 0; + state->whave = state->wsize; + } + else { + dist = state->wsize - state->wnext; + if (dist > copy) dist = copy; + zmemcpy(state->window + state->wnext, end - copy, dist); + copy -= dist; + if (copy) { + zmemcpy(state->window, end - copy, copy); + state->wnext = copy; + state->whave = state->wsize; + } + else { + state->wnext += dist; + if (state->wnext == state->wsize) state->wnext = 0; + if (state->whave < state->wsize) state->whave += dist; + } + } + return 0; +} + +/* Macros for inflate(): */ + +/* check function to use adler32() for zlib or crc32() for gzip */ +#ifdef GUNZIP +# define UPDATE(check, buf, len) \ + (state->flags ? crc32(check, buf, len) : adler32(check, buf, len)) +#else +# define UPDATE(check, buf, len) adler32(check, buf, len) +#endif + +/* check macros for header crc */ +#ifdef GUNZIP +# define CRC2(check, word) \ + do { \ + hbuf[0] = (unsigned char)(word); \ + hbuf[1] = (unsigned char)((word) >> 8); \ + check = crc32(check, hbuf, 2); \ + } while (0) + +# define CRC4(check, word) \ + do { \ + hbuf[0] = (unsigned char)(word); \ + hbuf[1] = (unsigned char)((word) >> 8); \ + hbuf[2] = (unsigned char)((word) >> 16); \ + hbuf[3] = (unsigned char)((word) >> 24); \ + check = crc32(check, hbuf, 4); \ + } while (0) +#endif + +/* Load registers with state in inflate() for speed */ +#define LOAD() \ + do { \ + put = strm->next_out; \ + left = strm->avail_out; \ + next = strm->next_in; \ + have = strm->avail_in; \ + hold = state->hold; \ + bits = state->bits; \ + } while (0) + +/* Restore state from registers in inflate() */ +#define RESTORE() \ + do { \ + strm->next_out = put; \ + strm->avail_out = left; \ + strm->next_in = next; \ + strm->avail_in = have; \ + state->hold = hold; \ + state->bits = bits; \ + } while (0) + +/* Clear the input bit accumulator */ +#define INITBITS() \ + do { \ + hold = 0; \ + bits = 0; \ + } while (0) + +/* Get a byte of input into the bit accumulator, or return from inflate() + if there is no input available. */ +#define PULLBYTE() \ + do { \ + if (have == 0) goto inf_leave; \ + have--; \ + hold += (unsigned long)(*next++) << bits; \ + bits += 8; \ + } while (0) + +/* Assure that there are at least n bits in the bit accumulator. If there is + not enough available input to do that, then return from inflate(). */ +#define NEEDBITS(n) \ + do { \ + while (bits < (unsigned)(n)) \ + PULLBYTE(); \ + } while (0) + +/* Return the low n bits of the bit accumulator (n < 16) */ +#define BITS(n) \ + ((unsigned)hold & ((1U << (n)) - 1)) + +/* Remove n bits from the bit accumulator */ +#define DROPBITS(n) \ + do { \ + hold >>= (n); \ + bits -= (unsigned)(n); \ + } while (0) + +/* Remove zero to seven bits as needed to go to a byte boundary */ +#define BYTEBITS() \ + do { \ + hold >>= bits & 7; \ + bits -= bits & 7; \ + } while (0) + +/* + inflate() uses a state machine to process as much input data and generate as + much output data as possible before returning. The state machine is + structured roughly as follows: + + for (;;) switch (state) { + ... + case STATEn: + if (not enough input data or output space to make progress) + return; + ... make progress ... + state = STATEm; + break; + ... + } + + so when inflate() is called again, the same case is attempted again, and + if the appropriate resources are provided, the machine proceeds to the + next state. The NEEDBITS() macro is usually the way the state evaluates + whether it can proceed or should return. NEEDBITS() does the return if + the requested bits are not available. The typical use of the BITS macros + is: + + NEEDBITS(n); + ... do something with BITS(n) ... + DROPBITS(n); + + where NEEDBITS(n) either returns from inflate() if there isn't enough + input left to load n bits into the accumulator, or it continues. BITS(n) + gives the low n bits in the accumulator. When done, DROPBITS(n) drops + the low n bits off the accumulator. INITBITS() clears the accumulator + and sets the number of available bits to zero. BYTEBITS() discards just + enough bits to put the accumulator on a byte boundary. After BYTEBITS() + and a NEEDBITS(8), then BITS(8) would return the next byte in the stream. + + NEEDBITS(n) uses PULLBYTE() to get an available byte of input, or to return + if there is no input available. The decoding of variable length codes uses + PULLBYTE() directly in order to pull just enough bytes to decode the next + code, and no more. + + Some states loop until they get enough input, making sure that enough + state information is maintained to continue the loop where it left off + if NEEDBITS() returns in the loop. For example, want, need, and keep + would all have to actually be part of the saved state in case NEEDBITS() + returns: + + case STATEw: + while (want < need) { + NEEDBITS(n); + keep[want++] = BITS(n); + DROPBITS(n); + } + state = STATEx; + case STATEx: + + As shown above, if the next state is also the next case, then the break + is omitted. + + A state may also return if there is not enough output space available to + complete that state. Those states are copying stored data, writing a + literal byte, and copying a matching string. + + When returning, a "goto inf_leave" is used to update the total counters, + update the check value, and determine whether any progress has been made + during that inflate() call in order to return the proper return code. + Progress is defined as a change in either strm->avail_in or strm->avail_out. + When there is a window, goto inf_leave will update the window with the last + output written. If a goto inf_leave occurs in the middle of decompression + and there is no window currently, goto inf_leave will create one and copy + output to the window for the next call of inflate(). + + In this implementation, the flush parameter of inflate() only affects the + return code (per zlib.h). inflate() always writes as much as possible to + strm->next_out, given the space available and the provided input--the effect + documented in zlib.h of Z_SYNC_FLUSH. Furthermore, inflate() always defers + the allocation of and copying into a sliding window until necessary, which + provides the effect documented in zlib.h for Z_FINISH when the entire input + stream available. So the only thing the flush parameter actually does is: + when flush is set to Z_FINISH, inflate() cannot return Z_OK. Instead it + will return Z_BUF_ERROR if it has not reached the end of the stream. + */ + +int ZEXPORT inflate(strm, flush) +z_streamp strm; +int flush; +{ + struct inflate_state FAR *state; + z_const unsigned char FAR *next; /* next input */ + unsigned char FAR *put; /* next output */ + unsigned have, left; /* available input and output */ + unsigned long hold; /* bit buffer */ + unsigned bits; /* bits in bit buffer */ + unsigned in, out; /* save starting available input and output */ + unsigned copy; /* number of stored or match bytes to copy */ + unsigned char FAR *from; /* where to copy match bytes from */ + code here; /* current decoding table entry */ + code last; /* parent table entry */ + unsigned len; /* length to copy for repeats, bits to drop */ + int ret; /* return code */ +#ifdef GUNZIP + unsigned char hbuf[4]; /* buffer for gzip header crc calculation */ +#endif + static const unsigned short order[19] = /* permutation of code lengths */ + {16, 17, 18, 0, 8, 7, 9, 6, 10, 5, 11, 4, 12, 3, 13, 2, 14, 1, 15}; + + if (inflateStateCheck(strm) || strm->next_out == Z_NULL || + (strm->next_in == Z_NULL && strm->avail_in != 0)) + return Z_STREAM_ERROR; + + state = (struct inflate_state FAR *)strm->state; + if (state->mode == TYPE) state->mode = TYPEDO; /* skip check */ + LOAD(); + in = have; + out = left; + ret = Z_OK; + for (;;) + switch (state->mode) { + case HEAD: + if (state->wrap == 0) { + state->mode = TYPEDO; + break; + } + NEEDBITS(16); +#ifdef GUNZIP + if ((state->wrap & 2) && hold == 0x8b1f) { /* gzip header */ + if (state->wbits == 0) + state->wbits = 15; + state->check = crc32(0L, Z_NULL, 0); + CRC2(state->check, hold); + INITBITS(); + state->mode = FLAGS; + break; + } + state->flags = 0; /* expect zlib header */ + if (state->head != Z_NULL) + state->head->done = -1; + if (!(state->wrap & 1) || /* check if zlib header allowed */ +#else + if ( +#endif + ((BITS(8) << 8) + (hold >> 8)) % 31) { + strm->msg = (char *)"incorrect header check"; + state->mode = BAD; + break; + } + if (BITS(4) != Z_DEFLATED) { + strm->msg = (char *)"unknown compression method"; + state->mode = BAD; + break; + } + DROPBITS(4); + len = BITS(4) + 8; + if (state->wbits == 0) + state->wbits = len; + if (len > 15 || len > state->wbits) { + strm->msg = (char *)"invalid window size"; + state->mode = BAD; + break; + } + state->dmax = 1U << len; + Tracev((stderr, "inflate: zlib header ok\n")); + strm->adler = state->check = adler32(0L, Z_NULL, 0); + state->mode = hold & 0x200 ? DICTID : TYPE; + INITBITS(); + break; +#ifdef GUNZIP + case FLAGS: + NEEDBITS(16); + state->flags = (int)(hold); + if ((state->flags & 0xff) != Z_DEFLATED) { + strm->msg = (char *)"unknown compression method"; + state->mode = BAD; + break; + } + if (state->flags & 0xe000) { + strm->msg = (char *)"unknown header flags set"; + state->mode = BAD; + break; + } + if (state->head != Z_NULL) + state->head->text = (int)((hold >> 8) & 1); + if ((state->flags & 0x0200) && (state->wrap & 4)) + CRC2(state->check, hold); + INITBITS(); + state->mode = TIME; + case TIME: + NEEDBITS(32); + if (state->head != Z_NULL) + state->head->time = hold; + if ((state->flags & 0x0200) && (state->wrap & 4)) + CRC4(state->check, hold); + INITBITS(); + state->mode = OS; + case OS: + NEEDBITS(16); + if (state->head != Z_NULL) { + state->head->xflags = (int)(hold & 0xff); + state->head->os = (int)(hold >> 8); + } + if ((state->flags & 0x0200) && (state->wrap & 4)) + CRC2(state->check, hold); + INITBITS(); + state->mode = EXLEN; + case EXLEN: + if (state->flags & 0x0400) { + NEEDBITS(16); + state->length = (unsigned)(hold); + if (state->head != Z_NULL) + state->head->extra_len = (unsigned)hold; + if ((state->flags & 0x0200) && (state->wrap & 4)) + CRC2(state->check, hold); + INITBITS(); + } + else if (state->head != Z_NULL) + state->head->extra = Z_NULL; + state->mode = EXTRA; + case EXTRA: + if (state->flags & 0x0400) { + copy = state->length; + if (copy > have) copy = have; + if (copy) { + if (state->head != Z_NULL && + state->head->extra != Z_NULL) { + len = state->head->extra_len - state->length; + zmemcpy(state->head->extra + len, next, + len + copy > state->head->extra_max ? + state->head->extra_max - len : copy); + } + if ((state->flags & 0x0200) && (state->wrap & 4)) + state->check = crc32(state->check, next, copy); + have -= copy; + next += copy; + state->length -= copy; + } + if (state->length) goto inf_leave; + } + state->length = 0; + state->mode = NAME; + case NAME: + if (state->flags & 0x0800) { + if (have == 0) goto inf_leave; + copy = 0; + do { + len = (unsigned)(next[copy++]); + if (state->head != Z_NULL && + state->head->name != Z_NULL && + state->length < state->head->name_max) + state->head->name[state->length++] = (Bytef)len; + } while (len && copy < have); + if ((state->flags & 0x0200) && (state->wrap & 4)) + state->check = crc32(state->check, next, copy); + have -= copy; + next += copy; + if (len) goto inf_leave; + } + else if (state->head != Z_NULL) + state->head->name = Z_NULL; + state->length = 0; + state->mode = COMMENT; + case COMMENT: + if (state->flags & 0x1000) { + if (have == 0) goto inf_leave; + copy = 0; + do { + len = (unsigned)(next[copy++]); + if (state->head != Z_NULL && + state->head->comment != Z_NULL && + state->length < state->head->comm_max) + state->head->comment[state->length++] = (Bytef)len; + } while (len && copy < have); + if ((state->flags & 0x0200) && (state->wrap & 4)) + state->check = crc32(state->check, next, copy); + have -= copy; + next += copy; + if (len) goto inf_leave; + } + else if (state->head != Z_NULL) + state->head->comment = Z_NULL; + state->mode = HCRC; + case HCRC: + if (state->flags & 0x0200) { + NEEDBITS(16); + if ((state->wrap & 4) && hold != (state->check & 0xffff)) { + strm->msg = (char *)"header crc mismatch"; + state->mode = BAD; + break; + } + INITBITS(); + } + if (state->head != Z_NULL) { + state->head->hcrc = (int)((state->flags >> 9) & 1); + state->head->done = 1; + } + strm->adler = state->check = crc32(0L, Z_NULL, 0); + state->mode = TYPE; + break; +#endif + case DICTID: + NEEDBITS(32); + strm->adler = state->check = ZSWAP32(hold); + INITBITS(); + state->mode = DICT; + case DICT: + if (state->havedict == 0) { + RESTORE(); + return Z_NEED_DICT; + } + strm->adler = state->check = adler32(0L, Z_NULL, 0); + state->mode = TYPE; + case TYPE: + if (flush == Z_BLOCK || flush == Z_TREES) goto inf_leave; + case TYPEDO: + if (state->last) { + BYTEBITS(); + state->mode = CHECK; + break; + } + NEEDBITS(3); + state->last = BITS(1); + DROPBITS(1); + switch (BITS(2)) { + case 0: /* stored block */ + Tracev((stderr, "inflate: stored block%s\n", + state->last ? " (last)" : "")); + state->mode = STORED; + break; + case 1: /* fixed block */ + fixedtables(state); + Tracev((stderr, "inflate: fixed codes block%s\n", + state->last ? " (last)" : "")); + state->mode = LEN_; /* decode codes */ + if (flush == Z_TREES) { + DROPBITS(2); + goto inf_leave; + } + break; + case 2: /* dynamic block */ + Tracev((stderr, "inflate: dynamic codes block%s\n", + state->last ? " (last)" : "")); + state->mode = TABLE; + break; + case 3: + strm->msg = (char *)"invalid block type"; + state->mode = BAD; + } + DROPBITS(2); + break; + case STORED: + BYTEBITS(); /* go to byte boundary */ + NEEDBITS(32); + if ((hold & 0xffff) != ((hold >> 16) ^ 0xffff)) { + strm->msg = (char *)"invalid stored block lengths"; + state->mode = BAD; + break; + } + state->length = (unsigned)hold & 0xffff; + Tracev((stderr, "inflate: stored length %u\n", + state->length)); + INITBITS(); + state->mode = COPY_; + if (flush == Z_TREES) goto inf_leave; + case COPY_: + state->mode = COPY; + case COPY: + copy = state->length; + if (copy) { + if (copy > have) copy = have; + if (copy > left) copy = left; + if (copy == 0) goto inf_leave; + zmemcpy(put, next, copy); + have -= copy; + next += copy; + left -= copy; + put += copy; + state->length -= copy; + break; + } + Tracev((stderr, "inflate: stored end\n")); + state->mode = TYPE; + break; + case TABLE: + NEEDBITS(14); + state->nlen = BITS(5) + 257; + DROPBITS(5); + state->ndist = BITS(5) + 1; + DROPBITS(5); + state->ncode = BITS(4) + 4; + DROPBITS(4); +#ifndef PKZIP_BUG_WORKAROUND + if (state->nlen > 286 || state->ndist > 30) { + strm->msg = (char *)"too many length or distance symbols"; + state->mode = BAD; + break; + } +#endif + Tracev((stderr, "inflate: table sizes ok\n")); + state->have = 0; + state->mode = LENLENS; + case LENLENS: + while (state->have < state->ncode) { + NEEDBITS(3); + state->lens[order[state->have++]] = (unsigned short)BITS(3); + DROPBITS(3); + } + while (state->have < 19) + state->lens[order[state->have++]] = 0; + state->next = state->codes; + state->lencode = (const code FAR *)(state->next); + state->lenbits = 7; + ret = inflate_table(CODES, state->lens, 19, &(state->next), + &(state->lenbits), state->work); + if (ret) { + strm->msg = (char *)"invalid code lengths set"; + state->mode = BAD; + break; + } + Tracev((stderr, "inflate: code lengths ok\n")); + state->have = 0; + state->mode = CODELENS; + case CODELENS: + while (state->have < state->nlen + state->ndist) { + for (;;) { + here = state->lencode[BITS(state->lenbits)]; + if ((unsigned)(here.bits) <= bits) break; + PULLBYTE(); + } + if (here.val < 16) { + DROPBITS(here.bits); + state->lens[state->have++] = here.val; + } + else { + if (here.val == 16) { + NEEDBITS(here.bits + 2); + DROPBITS(here.bits); + if (state->have == 0) { + strm->msg = (char *)"invalid bit length repeat"; + state->mode = BAD; + break; + } + len = state->lens[state->have - 1]; + copy = 3 + BITS(2); + DROPBITS(2); + } + else if (here.val == 17) { + NEEDBITS(here.bits + 3); + DROPBITS(here.bits); + len = 0; + copy = 3 + BITS(3); + DROPBITS(3); + } + else { + NEEDBITS(here.bits + 7); + DROPBITS(here.bits); + len = 0; + copy = 11 + BITS(7); + DROPBITS(7); + } + if (state->have + copy > state->nlen + state->ndist) { + strm->msg = (char *)"invalid bit length repeat"; + state->mode = BAD; + break; + } + while (copy--) + state->lens[state->have++] = (unsigned short)len; + } + } + + /* handle error breaks in while */ + if (state->mode == BAD) break; + + /* check for end-of-block code (better have one) */ + if (state->lens[256] == 0) { + strm->msg = (char *)"invalid code -- missing end-of-block"; + state->mode = BAD; + break; + } + + /* build code tables -- note: do not change the lenbits or distbits + values here (9 and 6) without reading the comments in inftrees.h + concerning the ENOUGH constants, which depend on those values */ + state->next = state->codes; + state->lencode = (const code FAR *)(state->next); + state->lenbits = 9; + ret = inflate_table(LENS, state->lens, state->nlen, &(state->next), + &(state->lenbits), state->work); + if (ret) { + strm->msg = (char *)"invalid literal/lengths set"; + state->mode = BAD; + break; + } + state->distcode = (const code FAR *)(state->next); + state->distbits = 6; + ret = inflate_table(DISTS, state->lens + state->nlen, state->ndist, + &(state->next), &(state->distbits), state->work); + if (ret) { + strm->msg = (char *)"invalid distances set"; + state->mode = BAD; + break; + } + Tracev((stderr, "inflate: codes ok\n")); + state->mode = LEN_; + if (flush == Z_TREES) goto inf_leave; + case LEN_: + state->mode = LEN; + case LEN: + if (have >= 6 && left >= 258) { + RESTORE(); + inflate_fast(strm, out); + LOAD(); + if (state->mode == TYPE) + state->back = -1; + break; + } + state->back = 0; + for (;;) { + here = state->lencode[BITS(state->lenbits)]; + if ((unsigned)(here.bits) <= bits) break; + PULLBYTE(); + } + if (here.op && (here.op & 0xf0) == 0) { + last = here; + for (;;) { + here = state->lencode[last.val + + (BITS(last.bits + last.op) >> last.bits)]; + if ((unsigned)(last.bits + here.bits) <= bits) break; + PULLBYTE(); + } + DROPBITS(last.bits); + state->back += last.bits; + } + DROPBITS(here.bits); + state->back += here.bits; + state->length = (unsigned)here.val; + if ((int)(here.op) == 0) { + Tracevv((stderr, here.val >= 0x20 && here.val < 0x7f ? + "inflate: literal '%c'\n" : + "inflate: literal 0x%02x\n", here.val)); + state->mode = LIT; + break; + } + if (here.op & 32) { + Tracevv((stderr, "inflate: end of block\n")); + state->back = -1; + state->mode = TYPE; + break; + } + if (here.op & 64) { + strm->msg = (char *)"invalid literal/length code"; + state->mode = BAD; + break; + } + state->extra = (unsigned)(here.op) & 15; + state->mode = LENEXT; + case LENEXT: + if (state->extra) { + NEEDBITS(state->extra); + state->length += BITS(state->extra); + DROPBITS(state->extra); + state->back += state->extra; + } + Tracevv((stderr, "inflate: length %u\n", state->length)); + state->was = state->length; + state->mode = DIST; + case DIST: + for (;;) { + here = state->distcode[BITS(state->distbits)]; + if ((unsigned)(here.bits) <= bits) break; + PULLBYTE(); + } + if ((here.op & 0xf0) == 0) { + last = here; + for (;;) { + here = state->distcode[last.val + + (BITS(last.bits + last.op) >> last.bits)]; + if ((unsigned)(last.bits + here.bits) <= bits) break; + PULLBYTE(); + } + DROPBITS(last.bits); + state->back += last.bits; + } + DROPBITS(here.bits); + state->back += here.bits; + if (here.op & 64) { + strm->msg = (char *)"invalid distance code"; + state->mode = BAD; + break; + } + state->offset = (unsigned)here.val; + state->extra = (unsigned)(here.op) & 15; + state->mode = DISTEXT; + case DISTEXT: + if (state->extra) { + NEEDBITS(state->extra); + state->offset += BITS(state->extra); + DROPBITS(state->extra); + state->back += state->extra; + } +#ifdef INFLATE_STRICT + if (state->offset > state->dmax) { + strm->msg = (char *)"invalid distance too far back"; + state->mode = BAD; + break; + } +#endif + Tracevv((stderr, "inflate: distance %u\n", state->offset)); + state->mode = MATCH; + case MATCH: + if (left == 0) goto inf_leave; + copy = out - left; + if (state->offset > copy) { /* copy from window */ + copy = state->offset - copy; + if (copy > state->whave) { + if (state->sane) { + strm->msg = (char *)"invalid distance too far back"; + state->mode = BAD; + break; + } +#ifdef INFLATE_ALLOW_INVALID_DISTANCE_TOOFAR_ARRR + Trace((stderr, "inflate.c too far\n")); + copy -= state->whave; + if (copy > state->length) copy = state->length; + if (copy > left) copy = left; + left -= copy; + state->length -= copy; + do { + *put++ = 0; + } while (--copy); + if (state->length == 0) state->mode = LEN; + break; +#endif + } + if (copy > state->wnext) { + copy -= state->wnext; + from = state->window + (state->wsize - copy); + } + else + from = state->window + (state->wnext - copy); + if (copy > state->length) copy = state->length; + } + else { /* copy from output */ + from = put - state->offset; + copy = state->length; + } + if (copy > left) copy = left; + left -= copy; + state->length -= copy; + do { + *put++ = *from++; + } while (--copy); + if (state->length == 0) state->mode = LEN; + break; + case LIT: + if (left == 0) goto inf_leave; + *put++ = (unsigned char)(state->length); + left--; + state->mode = LEN; + break; + case CHECK: + if (state->wrap) { + NEEDBITS(32); + out -= left; + strm->total_out += out; + state->total += out; + if ((state->wrap & 4) && out) + strm->adler = state->check = + UPDATE(state->check, put - out, out); + out = left; + if ((state->wrap & 4) && ( +#ifdef GUNZIP + state->flags ? hold : +#endif + ZSWAP32(hold)) != state->check) { + strm->msg = (char *)"incorrect data check"; + state->mode = BAD; + break; + } + INITBITS(); + Tracev((stderr, "inflate: check matches trailer\n")); + } +#ifdef GUNZIP + state->mode = LENGTH; + case LENGTH: + if (state->wrap && state->flags) { + NEEDBITS(32); + if (hold != (state->total & 0xffffffffUL)) { + strm->msg = (char *)"incorrect length check"; + state->mode = BAD; + break; + } + INITBITS(); + Tracev((stderr, "inflate: length matches trailer\n")); + } +#endif + state->mode = DONE; + case DONE: + ret = Z_STREAM_END; + goto inf_leave; + case BAD: + ret = Z_DATA_ERROR; + goto inf_leave; + case MEM: + return Z_MEM_ERROR; + case SYNC: + default: + return Z_STREAM_ERROR; + } + + /* + Return from inflate(), updating the total counts and the check value. + If there was no progress during the inflate() call, return a buffer + error. Call updatewindow() to create and/or update the window state. + Note: a memory error from inflate() is non-recoverable. + */ + inf_leave: + RESTORE(); + if (state->wsize || (out != strm->avail_out && state->mode < BAD && + (state->mode < CHECK || flush != Z_FINISH))) + if (updatewindow(strm, strm->next_out, out - strm->avail_out)) { + state->mode = MEM; + return Z_MEM_ERROR; + } + in -= strm->avail_in; + out -= strm->avail_out; + strm->total_in += in; + strm->total_out += out; + state->total += out; + if ((state->wrap & 4) && out) + strm->adler = state->check = + UPDATE(state->check, strm->next_out - out, out); + strm->data_type = (int)state->bits + (state->last ? 64 : 0) + + (state->mode == TYPE ? 128 : 0) + + (state->mode == LEN_ || state->mode == COPY_ ? 256 : 0); + if (((in == 0 && out == 0) || flush == Z_FINISH) && ret == Z_OK) + ret = Z_BUF_ERROR; + return ret; +} + +int ZEXPORT inflateEnd(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + if (inflateStateCheck(strm)) + return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + if (state->window != Z_NULL) ZFREE(strm, state->window); + ZFREE(strm, strm->state); + strm->state = Z_NULL; + Tracev((stderr, "inflate: end\n")); + return Z_OK; +} + +int ZEXPORT inflateGetDictionary(strm, dictionary, dictLength) +z_streamp strm; +Bytef *dictionary; +uInt *dictLength; +{ + struct inflate_state FAR *state; + + /* check state */ + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + + /* copy dictionary */ + if (state->whave && dictionary != Z_NULL) { + zmemcpy(dictionary, state->window + state->wnext, + state->whave - state->wnext); + zmemcpy(dictionary + state->whave - state->wnext, + state->window, state->wnext); + } + if (dictLength != Z_NULL) + *dictLength = state->whave; + return Z_OK; +} + +int ZEXPORT inflateSetDictionary(strm, dictionary, dictLength) +z_streamp strm; +const Bytef *dictionary; +uInt dictLength; +{ + struct inflate_state FAR *state; + unsigned long dictid; + int ret; + + /* check state */ + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + if (state->wrap != 0 && state->mode != DICT) + return Z_STREAM_ERROR; + + /* check for correct dictionary identifier */ + if (state->mode == DICT) { + dictid = adler32(0L, Z_NULL, 0); + dictid = adler32(dictid, dictionary, dictLength); + if (dictid != state->check) + return Z_DATA_ERROR; + } + + /* copy dictionary to window using updatewindow(), which will amend the + existing dictionary if appropriate */ + ret = updatewindow(strm, dictionary + dictLength, dictLength); + if (ret) { + state->mode = MEM; + return Z_MEM_ERROR; + } + state->havedict = 1; + Tracev((stderr, "inflate: dictionary set\n")); + return Z_OK; +} + +int ZEXPORT inflateGetHeader(strm, head) +z_streamp strm; +gz_headerp head; +{ + struct inflate_state FAR *state; + + /* check state */ + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + if ((state->wrap & 2) == 0) return Z_STREAM_ERROR; + + /* save header structure */ + state->head = head; + head->done = 0; + return Z_OK; +} + +/* + Search buf[0..len-1] for the pattern: 0, 0, 0xff, 0xff. Return when found + or when out of input. When called, *have is the number of pattern bytes + found in order so far, in 0..3. On return *have is updated to the new + state. If on return *have equals four, then the pattern was found and the + return value is how many bytes were read including the last byte of the + pattern. If *have is less than four, then the pattern has not been found + yet and the return value is len. In the latter case, syncsearch() can be + called again with more data and the *have state. *have is initialized to + zero for the first call. + */ +local unsigned syncsearch(have, buf, len) +unsigned FAR *have; +const unsigned char FAR *buf; +unsigned len; +{ + unsigned got; + unsigned next; + + got = *have; + next = 0; + while (next < len && got < 4) { + if ((int)(buf[next]) == (got < 2 ? 0 : 0xff)) + got++; + else if (buf[next]) + got = 0; + else + got = 4 - got; + next++; + } + *have = got; + return next; +} + +int ZEXPORT inflateSync(strm) +z_streamp strm; +{ + unsigned len; /* number of bytes to look at or looked at */ + unsigned long in, out; /* temporary to save total_in and total_out */ + unsigned char buf[4]; /* to restore bit buffer to byte string */ + struct inflate_state FAR *state; + + /* check parameters */ + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + if (strm->avail_in == 0 && state->bits < 8) return Z_BUF_ERROR; + + /* if first time, start search in bit buffer */ + if (state->mode != SYNC) { + state->mode = SYNC; + state->hold <<= state->bits & 7; + state->bits -= state->bits & 7; + len = 0; + while (state->bits >= 8) { + buf[len++] = (unsigned char)(state->hold); + state->hold >>= 8; + state->bits -= 8; + } + state->have = 0; + syncsearch(&(state->have), buf, len); + } + + /* search available input */ + len = syncsearch(&(state->have), strm->next_in, strm->avail_in); + strm->avail_in -= len; + strm->next_in += len; + strm->total_in += len; + + /* return no joy or set up to restart inflate() on a new block */ + if (state->have != 4) return Z_DATA_ERROR; + in = strm->total_in; out = strm->total_out; + inflateReset(strm); + strm->total_in = in; strm->total_out = out; + state->mode = TYPE; + return Z_OK; +} + +/* + Returns true if inflate is currently at the end of a block generated by + Z_SYNC_FLUSH or Z_FULL_FLUSH. This function is used by one PPP + implementation to provide an additional safety check. PPP uses + Z_SYNC_FLUSH but removes the length bytes of the resulting empty stored + block. When decompressing, PPP checks that at the end of input packet, + inflate is waiting for these length bytes. + */ +int ZEXPORT inflateSyncPoint(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + return state->mode == STORED && state->bits == 0; +} + +int ZEXPORT inflateCopy(dest, source) +z_streamp dest; +z_streamp source; +{ + struct inflate_state FAR *state; + struct inflate_state FAR *copy; + unsigned char FAR *window; + unsigned wsize; + + /* check input */ + if (inflateStateCheck(source) || dest == Z_NULL) + return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)source->state; + + /* allocate space */ + copy = (struct inflate_state FAR *) + ZALLOC(source, 1, sizeof(struct inflate_state)); + if (copy == Z_NULL) return Z_MEM_ERROR; + window = Z_NULL; + if (state->window != Z_NULL) { + window = (unsigned char FAR *) + ZALLOC(source, 1U << state->wbits, sizeof(unsigned char)); + if (window == Z_NULL) { + ZFREE(source, copy); + return Z_MEM_ERROR; + } + } + + /* copy state */ + zmemcpy((voidpf)dest, (voidpf)source, sizeof(z_stream)); + zmemcpy((voidpf)copy, (voidpf)state, sizeof(struct inflate_state)); + copy->strm = dest; + if (state->lencode >= state->codes && + state->lencode <= state->codes + ENOUGH - 1) { + copy->lencode = copy->codes + (state->lencode - state->codes); + copy->distcode = copy->codes + (state->distcode - state->codes); + } + copy->next = copy->codes + (state->next - state->codes); + if (window != Z_NULL) { + wsize = 1U << state->wbits; + zmemcpy(window, state->window, wsize); + } + copy->window = window; + dest->state = (struct internal_state FAR *)copy; + return Z_OK; +} + +int ZEXPORT inflateUndermine(strm, subvert) +z_streamp strm; +int subvert; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; +#ifdef INFLATE_ALLOW_INVALID_DISTANCE_TOOFAR_ARRR + state->sane = !subvert; + return Z_OK; +#else + (void)subvert; + state->sane = 1; + return Z_DATA_ERROR; +#endif +} + +int ZEXPORT inflateValidate(strm, check) +z_streamp strm; +int check; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) return Z_STREAM_ERROR; + state = (struct inflate_state FAR *)strm->state; + if (check) + state->wrap |= 4; + else + state->wrap &= ~4; + return Z_OK; +} + +long ZEXPORT inflateMark(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + + if (inflateStateCheck(strm)) + return -(1L << 16); + state = (struct inflate_state FAR *)strm->state; + return (long)(((unsigned long)((long)state->back)) << 16) + + (state->mode == COPY ? state->length : + (state->mode == MATCH ? state->was - state->length : 0)); +} + +unsigned long ZEXPORT inflateCodesUsed(strm) +z_streamp strm; +{ + struct inflate_state FAR *state; + if (inflateStateCheck(strm)) return (unsigned long)-1; + state = (struct inflate_state FAR *)strm->state; + return (unsigned long)(state->next - state->codes); +} diff --git a/PdbChecker/zlib/inflate.h b/PdbChecker/zlib/inflate.h new file mode 100644 index 0000000..a46cce6 --- /dev/null +++ b/PdbChecker/zlib/inflate.h @@ -0,0 +1,125 @@ +/* inflate.h -- internal inflate state definition + * Copyright (C) 1995-2016 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* WARNING: this file should *not* be used by applications. It is + part of the implementation of the compression library and is + subject to change. Applications should only use zlib.h. + */ + +/* define NO_GZIP when compiling if you want to disable gzip header and + trailer decoding by inflate(). NO_GZIP would be used to avoid linking in + the crc code when it is not needed. For shared libraries, gzip decoding + should be left enabled. */ +#ifndef NO_GZIP +# define GUNZIP +#endif + +/* Possible inflate modes between inflate() calls */ +typedef enum { + HEAD = 16180, /* i: waiting for magic header */ + FLAGS, /* i: waiting for method and flags (gzip) */ + TIME, /* i: waiting for modification time (gzip) */ + OS, /* i: waiting for extra flags and operating system (gzip) */ + EXLEN, /* i: waiting for extra length (gzip) */ + EXTRA, /* i: waiting for extra bytes (gzip) */ + NAME, /* i: waiting for end of file name (gzip) */ + COMMENT, /* i: waiting for end of comment (gzip) */ + HCRC, /* i: waiting for header crc (gzip) */ + DICTID, /* i: waiting for dictionary check value */ + DICT, /* waiting for inflateSetDictionary() call */ + TYPE, /* i: waiting for type bits, including last-flag bit */ + TYPEDO, /* i: same, but skip check to exit inflate on new block */ + STORED, /* i: waiting for stored size (length and complement) */ + COPY_, /* i/o: same as COPY below, but only first time in */ + COPY, /* i/o: waiting for input or output to copy stored block */ + TABLE, /* i: waiting for dynamic block table lengths */ + LENLENS, /* i: waiting for code length code lengths */ + CODELENS, /* i: waiting for length/lit and distance code lengths */ + LEN_, /* i: same as LEN below, but only first time in */ + LEN, /* i: waiting for length/lit/eob code */ + LENEXT, /* i: waiting for length extra bits */ + DIST, /* i: waiting for distance code */ + DISTEXT, /* i: waiting for distance extra bits */ + MATCH, /* o: waiting for output space to copy string */ + LIT, /* o: waiting for output space to write literal */ + CHECK, /* i: waiting for 32-bit check value */ + LENGTH, /* i: waiting for 32-bit length (gzip) */ + DONE, /* finished check, done -- remain here until reset */ + BAD, /* got a data error -- remain here until reset */ + MEM, /* got an inflate() memory error -- remain here until reset */ + SYNC /* looking for synchronization bytes to restart inflate() */ +} inflate_mode; + +/* + State transitions between above modes - + + (most modes can go to BAD or MEM on error -- not shown for clarity) + + Process header: + HEAD -> (gzip) or (zlib) or (raw) + (gzip) -> FLAGS -> TIME -> OS -> EXLEN -> EXTRA -> NAME -> COMMENT -> + HCRC -> TYPE + (zlib) -> DICTID or TYPE + DICTID -> DICT -> TYPE + (raw) -> TYPEDO + Read deflate blocks: + TYPE -> TYPEDO -> STORED or TABLE or LEN_ or CHECK + STORED -> COPY_ -> COPY -> TYPE + TABLE -> LENLENS -> CODELENS -> LEN_ + LEN_ -> LEN + Read deflate codes in fixed or dynamic block: + LEN -> LENEXT or LIT or TYPE + LENEXT -> DIST -> DISTEXT -> MATCH -> LEN + LIT -> LEN + Process trailer: + CHECK -> LENGTH -> DONE + */ + +/* State maintained between inflate() calls -- approximately 7K bytes, not + including the allocated sliding window, which is up to 32K bytes. */ +struct inflate_state { + z_streamp strm; /* pointer back to this zlib stream */ + inflate_mode mode; /* current inflate mode */ + int last; /* true if processing last block */ + int wrap; /* bit 0 true for zlib, bit 1 true for gzip, + bit 2 true to validate check value */ + int havedict; /* true if dictionary provided */ + int flags; /* gzip header method and flags (0 if zlib) */ + unsigned dmax; /* zlib header max distance (INFLATE_STRICT) */ + unsigned long check; /* protected copy of check value */ + unsigned long total; /* protected copy of output count */ + gz_headerp head; /* where to save gzip header information */ + /* sliding window */ + unsigned wbits; /* log base 2 of requested window size */ + unsigned wsize; /* window size or zero if not using window */ + unsigned whave; /* valid bytes in the window */ + unsigned wnext; /* window write index */ + unsigned char FAR *window; /* allocated sliding window, if needed */ + /* bit accumulator */ + unsigned long hold; /* input bit accumulator */ + unsigned bits; /* number of bits in "in" */ + /* for string and stored block copying */ + unsigned length; /* literal or length of data to copy */ + unsigned offset; /* distance back to copy string from */ + /* for table and code decoding */ + unsigned extra; /* extra bits needed */ + /* fixed and dynamic code tables */ + code const FAR *lencode; /* starting table for length/literal codes */ + code const FAR *distcode; /* starting table for distance codes */ + unsigned lenbits; /* index bits for lencode */ + unsigned distbits; /* index bits for distcode */ + /* dynamic table building */ + unsigned ncode; /* number of code length code lengths */ + unsigned nlen; /* number of length code lengths */ + unsigned ndist; /* number of distance code lengths */ + unsigned have; /* number of code lengths in lens[] */ + code FAR *next; /* next available space in codes[] */ + unsigned short lens[320]; /* temporary storage for code lengths */ + unsigned short work[288]; /* work area for code table building */ + code codes[ENOUGH]; /* space for code tables */ + int sane; /* if false, allow invalid distance too far */ + int back; /* bits back of last unprocessed length/lit */ + unsigned was; /* initial length of match */ +}; diff --git a/PdbChecker/zlib/inftrees.c b/PdbChecker/zlib/inftrees.c new file mode 100644 index 0000000..2ea08fc --- /dev/null +++ b/PdbChecker/zlib/inftrees.c @@ -0,0 +1,304 @@ +/* inftrees.c -- generate Huffman trees for efficient decoding + * Copyright (C) 1995-2017 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +#include "zutil.h" +#include "inftrees.h" + +#define MAXBITS 15 + +const char inflate_copyright[] = + " inflate 1.2.11 Copyright 1995-2017 Mark Adler "; +/* + If you use the zlib library in a product, an acknowledgment is welcome + in the documentation of your product. If for some reason you cannot + include such an acknowledgment, I would appreciate that you keep this + copyright string in the executable of your product. + */ + +/* + Build a set of tables to decode the provided canonical Huffman code. + The code lengths are lens[0..codes-1]. The result starts at *table, + whose indices are 0..2^bits-1. work is a writable array of at least + lens shorts, which is used as a work area. type is the type of code + to be generated, CODES, LENS, or DISTS. On return, zero is success, + -1 is an invalid code, and +1 means that ENOUGH isn't enough. table + on return points to the next available entry's address. bits is the + requested root table index bits, and on return it is the actual root + table index bits. It will differ if the request is greater than the + longest code or if it is less than the shortest code. + */ +int ZLIB_INTERNAL inflate_table(type, lens, codes, table, bits, work) +codetype type; +unsigned short FAR *lens; +unsigned codes; +code FAR * FAR *table; +unsigned FAR *bits; +unsigned short FAR *work; +{ + unsigned len; /* a code's length in bits */ + unsigned sym; /* index of code symbols */ + unsigned min, max; /* minimum and maximum code lengths */ + unsigned root; /* number of index bits for root table */ + unsigned curr; /* number of index bits for current table */ + unsigned drop; /* code bits to drop for sub-table */ + int left; /* number of prefix codes available */ + unsigned used; /* code entries in table used */ + unsigned huff; /* Huffman code */ + unsigned incr; /* for incrementing code, index */ + unsigned fill; /* index for replicating entries */ + unsigned low; /* low bits for current root entry */ + unsigned mask; /* mask for low root bits */ + code here; /* table entry for duplication */ + code FAR *next; /* next available space in table */ + const unsigned short FAR *base; /* base value table to use */ + const unsigned short FAR *extra; /* extra bits table to use */ + unsigned match; /* use base and extra for symbol >= match */ + unsigned short count[MAXBITS+1]; /* number of codes of each length */ + unsigned short offs[MAXBITS+1]; /* offsets in table for each length */ + static const unsigned short lbase[31] = { /* Length codes 257..285 base */ + 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 15, 17, 19, 23, 27, 31, + 35, 43, 51, 59, 67, 83, 99, 115, 131, 163, 195, 227, 258, 0, 0}; + static const unsigned short lext[31] = { /* Length codes 257..285 extra */ + 16, 16, 16, 16, 16, 16, 16, 16, 17, 17, 17, 17, 18, 18, 18, 18, + 19, 19, 19, 19, 20, 20, 20, 20, 21, 21, 21, 21, 16, 77, 202}; + static const unsigned short dbase[32] = { /* Distance codes 0..29 base */ + 1, 2, 3, 4, 5, 7, 9, 13, 17, 25, 33, 49, 65, 97, 129, 193, + 257, 385, 513, 769, 1025, 1537, 2049, 3073, 4097, 6145, + 8193, 12289, 16385, 24577, 0, 0}; + static const unsigned short dext[32] = { /* Distance codes 0..29 extra */ + 16, 16, 16, 16, 17, 17, 18, 18, 19, 19, 20, 20, 21, 21, 22, 22, + 23, 23, 24, 24, 25, 25, 26, 26, 27, 27, + 28, 28, 29, 29, 64, 64}; + + /* + Process a set of code lengths to create a canonical Huffman code. The + code lengths are lens[0..codes-1]. Each length corresponds to the + symbols 0..codes-1. The Huffman code is generated by first sorting the + symbols by length from short to long, and retaining the symbol order + for codes with equal lengths. Then the code starts with all zero bits + for the first code of the shortest length, and the codes are integer + increments for the same length, and zeros are appended as the length + increases. For the deflate format, these bits are stored backwards + from their more natural integer increment ordering, and so when the + decoding tables are built in the large loop below, the integer codes + are incremented backwards. + + This routine assumes, but does not check, that all of the entries in + lens[] are in the range 0..MAXBITS. The caller must assure this. + 1..MAXBITS is interpreted as that code length. zero means that that + symbol does not occur in this code. + + The codes are sorted by computing a count of codes for each length, + creating from that a table of starting indices for each length in the + sorted table, and then entering the symbols in order in the sorted + table. The sorted table is work[], with that space being provided by + the caller. + + The length counts are used for other purposes as well, i.e. finding + the minimum and maximum length codes, determining if there are any + codes at all, checking for a valid set of lengths, and looking ahead + at length counts to determine sub-table sizes when building the + decoding tables. + */ + + /* accumulate lengths for codes (assumes lens[] all in 0..MAXBITS) */ + for (len = 0; len <= MAXBITS; len++) + count[len] = 0; + for (sym = 0; sym < codes; sym++) + count[lens[sym]]++; + + /* bound code lengths, force root to be within code lengths */ + root = *bits; + for (max = MAXBITS; max >= 1; max--) + if (count[max] != 0) break; + if (root > max) root = max; + if (max == 0) { /* no symbols to code at all */ + here.op = (unsigned char)64; /* invalid code marker */ + here.bits = (unsigned char)1; + here.val = (unsigned short)0; + *(*table)++ = here; /* make a table to force an error */ + *(*table)++ = here; + *bits = 1; + return 0; /* no symbols, but wait for decoding to report error */ + } + for (min = 1; min < max; min++) + if (count[min] != 0) break; + if (root < min) root = min; + + /* check for an over-subscribed or incomplete set of lengths */ + left = 1; + for (len = 1; len <= MAXBITS; len++) { + left <<= 1; + left -= count[len]; + if (left < 0) return -1; /* over-subscribed */ + } + if (left > 0 && (type == CODES || max != 1)) + return -1; /* incomplete set */ + + /* generate offsets into symbol table for each length for sorting */ + offs[1] = 0; + for (len = 1; len < MAXBITS; len++) + offs[len + 1] = offs[len] + count[len]; + + /* sort symbols by length, by symbol order within each length */ + for (sym = 0; sym < codes; sym++) + if (lens[sym] != 0) work[offs[lens[sym]]++] = (unsigned short)sym; + + /* + Create and fill in decoding tables. In this loop, the table being + filled is at next and has curr index bits. The code being used is huff + with length len. That code is converted to an index by dropping drop + bits off of the bottom. For codes where len is less than drop + curr, + those top drop + curr - len bits are incremented through all values to + fill the table with replicated entries. + + root is the number of index bits for the root table. When len exceeds + root, sub-tables are created pointed to by the root entry with an index + of the low root bits of huff. This is saved in low to check for when a + new sub-table should be started. drop is zero when the root table is + being filled, and drop is root when sub-tables are being filled. + + When a new sub-table is needed, it is necessary to look ahead in the + code lengths to determine what size sub-table is needed. The length + counts are used for this, and so count[] is decremented as codes are + entered in the tables. + + used keeps track of how many table entries have been allocated from the + provided *table space. It is checked for LENS and DIST tables against + the constants ENOUGH_LENS and ENOUGH_DISTS to guard against changes in + the initial root table size constants. See the comments in inftrees.h + for more information. + + sym increments through all symbols, and the loop terminates when + all codes of length max, i.e. all codes, have been processed. This + routine permits incomplete codes, so another loop after this one fills + in the rest of the decoding tables with invalid code markers. + */ + + /* set up for code type */ + switch (type) { + case CODES: + base = extra = work; /* dummy value--not used */ + match = 20; + break; + case LENS: + base = lbase; + extra = lext; + match = 257; + break; + default: /* DISTS */ + base = dbase; + extra = dext; + match = 0; + } + + /* initialize state for loop */ + huff = 0; /* starting code */ + sym = 0; /* starting code symbol */ + len = min; /* starting code length */ + next = *table; /* current table to fill in */ + curr = root; /* current table index bits */ + drop = 0; /* current bits to drop from code for index */ + low = (unsigned)(-1); /* trigger new sub-table when len > root */ + used = 1U << root; /* use root table entries */ + mask = used - 1; /* mask for comparing low */ + + /* check available table space */ + if ((type == LENS && used > ENOUGH_LENS) || + (type == DISTS && used > ENOUGH_DISTS)) + return 1; + + /* process all codes and make table entries */ + for (;;) { + /* create table entry */ + here.bits = (unsigned char)(len - drop); + if (work[sym] + 1U < match) { + here.op = (unsigned char)0; + here.val = work[sym]; + } + else if (work[sym] >= match) { + here.op = (unsigned char)(extra[work[sym] - match]); + here.val = base[work[sym] - match]; + } + else { + here.op = (unsigned char)(32 + 64); /* end of block */ + here.val = 0; + } + + /* replicate for those indices with low len bits equal to huff */ + incr = 1U << (len - drop); + fill = 1U << curr; + min = fill; /* save offset to next table */ + do { + fill -= incr; + next[(huff >> drop) + fill] = here; + } while (fill != 0); + + /* backwards increment the len-bit code huff */ + incr = 1U << (len - 1); + while (huff & incr) + incr >>= 1; + if (incr != 0) { + huff &= incr - 1; + huff += incr; + } + else + huff = 0; + + /* go to next symbol, update count, len */ + sym++; + if (--(count[len]) == 0) { + if (len == max) break; + len = lens[work[sym]]; + } + + /* create new sub-table if needed */ + if (len > root && (huff & mask) != low) { + /* if first time, transition to sub-tables */ + if (drop == 0) + drop = root; + + /* increment past last table */ + next += min; /* here min is 1 << curr */ + + /* determine length of next table */ + curr = len - drop; + left = (int)(1 << curr); + while (curr + drop < max) { + left -= count[curr + drop]; + if (left <= 0) break; + curr++; + left <<= 1; + } + + /* check for enough space */ + used += 1U << curr; + if ((type == LENS && used > ENOUGH_LENS) || + (type == DISTS && used > ENOUGH_DISTS)) + return 1; + + /* point entry in root table to sub-table */ + low = huff & mask; + (*table)[low].op = (unsigned char)curr; + (*table)[low].bits = (unsigned char)root; + (*table)[low].val = (unsigned short)(next - *table); + } + } + + /* fill in remaining table entry if code is incomplete (guaranteed to have + at most one remaining entry, since if the code is incomplete, the + maximum code length that was allowed to get this far is one bit) */ + if (huff != 0) { + here.op = (unsigned char)64; /* invalid code marker */ + here.bits = (unsigned char)(len - drop); + here.val = (unsigned short)0; + next[huff] = here; + } + + /* set return parameters */ + *table += used; + *bits = root; + return 0; +} diff --git a/PdbChecker/zlib/inftrees.h b/PdbChecker/zlib/inftrees.h new file mode 100644 index 0000000..baa53a0 --- /dev/null +++ b/PdbChecker/zlib/inftrees.h @@ -0,0 +1,62 @@ +/* inftrees.h -- header to use inftrees.c + * Copyright (C) 1995-2005, 2010 Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* WARNING: this file should *not* be used by applications. It is + part of the implementation of the compression library and is + subject to change. Applications should only use zlib.h. + */ + +/* Structure for decoding tables. Each entry provides either the + information needed to do the operation requested by the code that + indexed that table entry, or it provides a pointer to another + table that indexes more bits of the code. op indicates whether + the entry is a pointer to another table, a literal, a length or + distance, an end-of-block, or an invalid code. For a table + pointer, the low four bits of op is the number of index bits of + that table. For a length or distance, the low four bits of op + is the number of extra bits to get after the code. bits is + the number of bits in this code or part of the code to drop off + of the bit buffer. val is the actual byte to output in the case + of a literal, the base length or distance, or the offset from + the current table to the next table. Each entry is four bytes. */ +typedef struct { + unsigned char op; /* operation, extra bits, table bits */ + unsigned char bits; /* bits in this part of the code */ + unsigned short val; /* offset in table or code value */ +} code; + +/* op values as set by inflate_table(): + 00000000 - literal + 0000tttt - table link, tttt != 0 is the number of table index bits + 0001eeee - length or distance, eeee is the number of extra bits + 01100000 - end of block + 01000000 - invalid code + */ + +/* Maximum size of the dynamic table. The maximum number of code structures is + 1444, which is the sum of 852 for literal/length codes and 592 for distance + codes. These values were found by exhaustive searches using the program + examples/enough.c found in the zlib distribtution. The arguments to that + program are the number of symbols, the initial root table size, and the + maximum bit length of a code. "enough 286 9 15" for literal/length codes + returns returns 852, and "enough 30 6 15" for distance codes returns 592. + The initial root table size (9 or 6) is found in the fifth argument of the + inflate_table() calls in inflate.c and infback.c. If the root table size is + changed, then these maximum sizes would be need to be recalculated and + updated. */ +#define ENOUGH_LENS 852 +#define ENOUGH_DISTS 592 +#define ENOUGH (ENOUGH_LENS+ENOUGH_DISTS) + +/* Type of code to build for inflate_table() */ +typedef enum { + CODES, + LENS, + DISTS +} codetype; + +int ZLIB_INTERNAL inflate_table OF((codetype type, unsigned short FAR *lens, + unsigned codes, code FAR * FAR *table, + unsigned FAR *bits, unsigned short FAR *work)); diff --git a/PdbChecker/zlib/trees.c b/PdbChecker/zlib/trees.c new file mode 100644 index 0000000..50cf4b4 --- /dev/null +++ b/PdbChecker/zlib/trees.c @@ -0,0 +1,1203 @@ +/* trees.c -- output deflated data using Huffman coding + * Copyright (C) 1995-2017 Jean-loup Gailly + * detect_data_type() function provided freely by Cosmin Truta, 2006 + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* + * ALGORITHM + * + * The "deflation" process uses several Huffman trees. The more + * common source values are represented by shorter bit sequences. + * + * Each code tree is stored in a compressed form which is itself + * a Huffman encoding of the lengths of all the code strings (in + * ascending order by source values). The actual code strings are + * reconstructed from the lengths in the inflate process, as described + * in the deflate specification. + * + * REFERENCES + * + * Deutsch, L.P.,"'Deflate' Compressed Data Format Specification". + * Available in ftp.uu.net:/pub/archiving/zip/doc/deflate-1.1.doc + * + * Storer, James A. + * Data Compression: Methods and Theory, pp. 49-50. + * Computer Science Press, 1988. ISBN 0-7167-8156-5. + * + * Sedgewick, R. + * Algorithms, p290. + * Addison-Wesley, 1983. ISBN 0-201-06672-6. + */ + +/* @(#) $Id$ */ + +/* #define GEN_TREES_H */ + +#include "deflate.h" + +#ifdef ZLIB_DEBUG +# include +#endif + +/* =========================================================================== + * Constants + */ + +#define MAX_BL_BITS 7 +/* Bit length codes must not exceed MAX_BL_BITS bits */ + +#define END_BLOCK 256 +/* end of block literal code */ + +#define REP_3_6 16 +/* repeat previous bit length 3-6 times (2 bits of repeat count) */ + +#define REPZ_3_10 17 +/* repeat a zero length 3-10 times (3 bits of repeat count) */ + +#define REPZ_11_138 18 +/* repeat a zero length 11-138 times (7 bits of repeat count) */ + +local const int extra_lbits[LENGTH_CODES] /* extra bits for each length code */ + = {0,0,0,0,0,0,0,0,1,1,1,1,2,2,2,2,3,3,3,3,4,4,4,4,5,5,5,5,0}; + +local const int extra_dbits[D_CODES] /* extra bits for each distance code */ + = {0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,12,12,13,13}; + +local const int extra_blbits[BL_CODES]/* extra bits for each bit length code */ + = {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2,3,7}; + +local const uch bl_order[BL_CODES] + = {16,17,18,0,8,7,9,6,10,5,11,4,12,3,13,2,14,1,15}; +/* The lengths of the bit length codes are sent in order of decreasing + * probability, to avoid transmitting the lengths for unused bit length codes. + */ + +/* =========================================================================== + * Local data. These are initialized only once. + */ + +#define DIST_CODE_LEN 512 /* see definition of array dist_code below */ + +#if defined(GEN_TREES_H) || !defined(STDC) +/* non ANSI compilers may not accept trees.h */ + +local ct_data static_ltree[L_CODES+2]; +/* The static literal tree. Since the bit lengths are imposed, there is no + * need for the L_CODES extra codes used during heap construction. However + * The codes 286 and 287 are needed to build a canonical tree (see _tr_init + * below). + */ + +local ct_data static_dtree[D_CODES]; +/* The static distance tree. (Actually a trivial tree since all codes use + * 5 bits.) + */ + +uch _dist_code[DIST_CODE_LEN]; +/* Distance codes. The first 256 values correspond to the distances + * 3 .. 258, the last 256 values correspond to the top 8 bits of + * the 15 bit distances. + */ + +uch _length_code[MAX_MATCH-MIN_MATCH+1]; +/* length code for each normalized match length (0 == MIN_MATCH) */ + +local int base_length[LENGTH_CODES]; +/* First normalized length for each code (0 = MIN_MATCH) */ + +local int base_dist[D_CODES]; +/* First normalized distance for each code (0 = distance of 1) */ + +#else +# include "trees.h" +#endif /* GEN_TREES_H */ + +struct static_tree_desc_s { + const ct_data *static_tree; /* static tree or NULL */ + const intf *extra_bits; /* extra bits for each code or NULL */ + int extra_base; /* base index for extra_bits */ + int elems; /* max number of elements in the tree */ + int max_length; /* max bit length for the codes */ +}; + +local const static_tree_desc static_l_desc = +{static_ltree, extra_lbits, LITERALS+1, L_CODES, MAX_BITS}; + +local const static_tree_desc static_d_desc = +{static_dtree, extra_dbits, 0, D_CODES, MAX_BITS}; + +local const static_tree_desc static_bl_desc = +{(const ct_data *)0, extra_blbits, 0, BL_CODES, MAX_BL_BITS}; + +/* =========================================================================== + * Local (static) routines in this file. + */ + +local void tr_static_init OF((void)); +local void init_block OF((deflate_state *s)); +local void pqdownheap OF((deflate_state *s, ct_data *tree, int k)); +local void gen_bitlen OF((deflate_state *s, tree_desc *desc)); +local void gen_codes OF((ct_data *tree, int max_code, ushf *bl_count)); +local void build_tree OF((deflate_state *s, tree_desc *desc)); +local void scan_tree OF((deflate_state *s, ct_data *tree, int max_code)); +local void send_tree OF((deflate_state *s, ct_data *tree, int max_code)); +local int build_bl_tree OF((deflate_state *s)); +local void send_all_trees OF((deflate_state *s, int lcodes, int dcodes, + int blcodes)); +local void compress_block OF((deflate_state *s, const ct_data *ltree, + const ct_data *dtree)); +local int detect_data_type OF((deflate_state *s)); +local unsigned bi_reverse OF((unsigned value, int length)); +local void bi_windup OF((deflate_state *s)); +local void bi_flush OF((deflate_state *s)); + +#ifdef GEN_TREES_H +local void gen_trees_header OF((void)); +#endif + +#ifndef ZLIB_DEBUG +# define send_code(s, c, tree) send_bits(s, tree[c].Code, tree[c].Len) + /* Send a code of the given tree. c and tree must not have side effects */ + +#else /* !ZLIB_DEBUG */ +# define send_code(s, c, tree) \ + { if (z_verbose>2) fprintf(stderr,"\ncd %3d ",(c)); \ + send_bits(s, tree[c].Code, tree[c].Len); } +#endif + +/* =========================================================================== + * Output a short LSB first on the stream. + * IN assertion: there is enough room in pendingBuf. + */ +#define put_short(s, w) { \ + put_byte(s, (uch)((w) & 0xff)); \ + put_byte(s, (uch)((ush)(w) >> 8)); \ +} + +/* =========================================================================== + * Send a value on a given number of bits. + * IN assertion: length <= 16 and value fits in length bits. + */ +#ifdef ZLIB_DEBUG +local void send_bits OF((deflate_state *s, int value, int length)); + +local void send_bits(s, value, length) + deflate_state *s; + int value; /* value to send */ + int length; /* number of bits */ +{ + Tracevv((stderr," l %2d v %4x ", length, value)); + Assert(length > 0 && length <= 15, "invalid length"); + s->bits_sent += (ulg)length; + + /* If not enough room in bi_buf, use (valid) bits from bi_buf and + * (16 - bi_valid) bits from value, leaving (width - (16-bi_valid)) + * unused bits in value. + */ + if (s->bi_valid > (int)Buf_size - length) { + s->bi_buf |= (ush)value << s->bi_valid; + put_short(s, s->bi_buf); + s->bi_buf = (ush)value >> (Buf_size - s->bi_valid); + s->bi_valid += length - Buf_size; + } else { + s->bi_buf |= (ush)value << s->bi_valid; + s->bi_valid += length; + } +} +#else /* !ZLIB_DEBUG */ + +#define send_bits(s, value, length) \ +{ int len = length;\ + if (s->bi_valid > (int)Buf_size - len) {\ + int val = (int)value;\ + s->bi_buf |= (ush)val << s->bi_valid;\ + put_short(s, s->bi_buf);\ + s->bi_buf = (ush)val >> (Buf_size - s->bi_valid);\ + s->bi_valid += len - Buf_size;\ + } else {\ + s->bi_buf |= (ush)(value) << s->bi_valid;\ + s->bi_valid += len;\ + }\ +} +#endif /* ZLIB_DEBUG */ + + +/* the arguments must not have side effects */ + +/* =========================================================================== + * Initialize the various 'constant' tables. + */ +local void tr_static_init() +{ +#if defined(GEN_TREES_H) || !defined(STDC) + static int static_init_done = 0; + int n; /* iterates over tree elements */ + int bits; /* bit counter */ + int length; /* length value */ + int code; /* code value */ + int dist; /* distance index */ + ush bl_count[MAX_BITS+1]; + /* number of codes at each bit length for an optimal tree */ + + if (static_init_done) return; + + /* For some embedded targets, global variables are not initialized: */ +#ifdef NO_INIT_GLOBAL_POINTERS + static_l_desc.static_tree = static_ltree; + static_l_desc.extra_bits = extra_lbits; + static_d_desc.static_tree = static_dtree; + static_d_desc.extra_bits = extra_dbits; + static_bl_desc.extra_bits = extra_blbits; +#endif + + /* Initialize the mapping length (0..255) -> length code (0..28) */ + length = 0; + for (code = 0; code < LENGTH_CODES-1; code++) { + base_length[code] = length; + for (n = 0; n < (1< dist code (0..29) */ + dist = 0; + for (code = 0 ; code < 16; code++) { + base_dist[code] = dist; + for (n = 0; n < (1<>= 7; /* from now on, all distances are divided by 128 */ + for ( ; code < D_CODES; code++) { + base_dist[code] = dist << 7; + for (n = 0; n < (1<<(extra_dbits[code]-7)); n++) { + _dist_code[256 + dist++] = (uch)code; + } + } + Assert (dist == 256, "tr_static_init: 256+dist != 512"); + + /* Construct the codes of the static literal tree */ + for (bits = 0; bits <= MAX_BITS; bits++) bl_count[bits] = 0; + n = 0; + while (n <= 143) static_ltree[n++].Len = 8, bl_count[8]++; + while (n <= 255) static_ltree[n++].Len = 9, bl_count[9]++; + while (n <= 279) static_ltree[n++].Len = 7, bl_count[7]++; + while (n <= 287) static_ltree[n++].Len = 8, bl_count[8]++; + /* Codes 286 and 287 do not exist, but we must include them in the + * tree construction to get a canonical Huffman tree (longest code + * all ones) + */ + gen_codes((ct_data *)static_ltree, L_CODES+1, bl_count); + + /* The static distance tree is trivial: */ + for (n = 0; n < D_CODES; n++) { + static_dtree[n].Len = 5; + static_dtree[n].Code = bi_reverse((unsigned)n, 5); + } + static_init_done = 1; + +# ifdef GEN_TREES_H + gen_trees_header(); +# endif +#endif /* defined(GEN_TREES_H) || !defined(STDC) */ +} + +/* =========================================================================== + * Genererate the file trees.h describing the static trees. + */ +#ifdef GEN_TREES_H +# ifndef ZLIB_DEBUG +# include +# endif + +# define SEPARATOR(i, last, width) \ + ((i) == (last)? "\n};\n\n" : \ + ((i) % (width) == (width)-1 ? ",\n" : ", ")) + +void gen_trees_header() +{ + FILE *header = fopen("trees.h", "w"); + int i; + + Assert (header != NULL, "Can't open trees.h"); + fprintf(header, + "/* header created automatically with -DGEN_TREES_H */\n\n"); + + fprintf(header, "local const ct_data static_ltree[L_CODES+2] = {\n"); + for (i = 0; i < L_CODES+2; i++) { + fprintf(header, "{{%3u},{%3u}}%s", static_ltree[i].Code, + static_ltree[i].Len, SEPARATOR(i, L_CODES+1, 5)); + } + + fprintf(header, "local const ct_data static_dtree[D_CODES] = {\n"); + for (i = 0; i < D_CODES; i++) { + fprintf(header, "{{%2u},{%2u}}%s", static_dtree[i].Code, + static_dtree[i].Len, SEPARATOR(i, D_CODES-1, 5)); + } + + fprintf(header, "const uch ZLIB_INTERNAL _dist_code[DIST_CODE_LEN] = {\n"); + for (i = 0; i < DIST_CODE_LEN; i++) { + fprintf(header, "%2u%s", _dist_code[i], + SEPARATOR(i, DIST_CODE_LEN-1, 20)); + } + + fprintf(header, + "const uch ZLIB_INTERNAL _length_code[MAX_MATCH-MIN_MATCH+1]= {\n"); + for (i = 0; i < MAX_MATCH-MIN_MATCH+1; i++) { + fprintf(header, "%2u%s", _length_code[i], + SEPARATOR(i, MAX_MATCH-MIN_MATCH, 20)); + } + + fprintf(header, "local const int base_length[LENGTH_CODES] = {\n"); + for (i = 0; i < LENGTH_CODES; i++) { + fprintf(header, "%1u%s", base_length[i], + SEPARATOR(i, LENGTH_CODES-1, 20)); + } + + fprintf(header, "local const int base_dist[D_CODES] = {\n"); + for (i = 0; i < D_CODES; i++) { + fprintf(header, "%5u%s", base_dist[i], + SEPARATOR(i, D_CODES-1, 10)); + } + + fclose(header); +} +#endif /* GEN_TREES_H */ + +/* =========================================================================== + * Initialize the tree data structures for a new zlib stream. + */ +void ZLIB_INTERNAL _tr_init(s) + deflate_state *s; +{ + tr_static_init(); + + s->l_desc.dyn_tree = s->dyn_ltree; + s->l_desc.stat_desc = &static_l_desc; + + s->d_desc.dyn_tree = s->dyn_dtree; + s->d_desc.stat_desc = &static_d_desc; + + s->bl_desc.dyn_tree = s->bl_tree; + s->bl_desc.stat_desc = &static_bl_desc; + + s->bi_buf = 0; + s->bi_valid = 0; +#ifdef ZLIB_DEBUG + s->compressed_len = 0L; + s->bits_sent = 0L; +#endif + + /* Initialize the first block of the first file: */ + init_block(s); +} + +/* =========================================================================== + * Initialize a new block. + */ +local void init_block(s) + deflate_state *s; +{ + int n; /* iterates over tree elements */ + + /* Initialize the trees. */ + for (n = 0; n < L_CODES; n++) s->dyn_ltree[n].Freq = 0; + for (n = 0; n < D_CODES; n++) s->dyn_dtree[n].Freq = 0; + for (n = 0; n < BL_CODES; n++) s->bl_tree[n].Freq = 0; + + s->dyn_ltree[END_BLOCK].Freq = 1; + s->opt_len = s->static_len = 0L; + s->last_lit = s->matches = 0; +} + +#define SMALLEST 1 +/* Index within the heap array of least frequent node in the Huffman tree */ + + +/* =========================================================================== + * Remove the smallest element from the heap and recreate the heap with + * one less element. Updates heap and heap_len. + */ +#define pqremove(s, tree, top) \ +{\ + top = s->heap[SMALLEST]; \ + s->heap[SMALLEST] = s->heap[s->heap_len--]; \ + pqdownheap(s, tree, SMALLEST); \ +} + +/* =========================================================================== + * Compares to subtrees, using the tree depth as tie breaker when + * the subtrees have equal frequency. This minimizes the worst case length. + */ +#define smaller(tree, n, m, depth) \ + (tree[n].Freq < tree[m].Freq || \ + (tree[n].Freq == tree[m].Freq && depth[n] <= depth[m])) + +/* =========================================================================== + * Restore the heap property by moving down the tree starting at node k, + * exchanging a node with the smallest of its two sons if necessary, stopping + * when the heap property is re-established (each father smaller than its + * two sons). + */ +local void pqdownheap(s, tree, k) + deflate_state *s; + ct_data *tree; /* the tree to restore */ + int k; /* node to move down */ +{ + int v = s->heap[k]; + int j = k << 1; /* left son of k */ + while (j <= s->heap_len) { + /* Set j to the smallest of the two sons: */ + if (j < s->heap_len && + smaller(tree, s->heap[j+1], s->heap[j], s->depth)) { + j++; + } + /* Exit if v is smaller than both sons */ + if (smaller(tree, v, s->heap[j], s->depth)) break; + + /* Exchange v with the smallest son */ + s->heap[k] = s->heap[j]; k = j; + + /* And continue down the tree, setting j to the left son of k */ + j <<= 1; + } + s->heap[k] = v; +} + +/* =========================================================================== + * Compute the optimal bit lengths for a tree and update the total bit length + * for the current block. + * IN assertion: the fields freq and dad are set, heap[heap_max] and + * above are the tree nodes sorted by increasing frequency. + * OUT assertions: the field len is set to the optimal bit length, the + * array bl_count contains the frequencies for each bit length. + * The length opt_len is updated; static_len is also updated if stree is + * not null. + */ +local void gen_bitlen(s, desc) + deflate_state *s; + tree_desc *desc; /* the tree descriptor */ +{ + ct_data *tree = desc->dyn_tree; + int max_code = desc->max_code; + const ct_data *stree = desc->stat_desc->static_tree; + const intf *extra = desc->stat_desc->extra_bits; + int base = desc->stat_desc->extra_base; + int max_length = desc->stat_desc->max_length; + int h; /* heap index */ + int n, m; /* iterate over the tree elements */ + int bits; /* bit length */ + int xbits; /* extra bits */ + ush f; /* frequency */ + int overflow = 0; /* number of elements with bit length too large */ + + for (bits = 0; bits <= MAX_BITS; bits++) s->bl_count[bits] = 0; + + /* In a first pass, compute the optimal bit lengths (which may + * overflow in the case of the bit length tree). + */ + tree[s->heap[s->heap_max]].Len = 0; /* root of the heap */ + + for (h = s->heap_max+1; h < HEAP_SIZE; h++) { + n = s->heap[h]; + bits = tree[tree[n].Dad].Len + 1; + if (bits > max_length) bits = max_length, overflow++; + tree[n].Len = (ush)bits; + /* We overwrite tree[n].Dad which is no longer needed */ + + if (n > max_code) continue; /* not a leaf node */ + + s->bl_count[bits]++; + xbits = 0; + if (n >= base) xbits = extra[n-base]; + f = tree[n].Freq; + s->opt_len += (ulg)f * (unsigned)(bits + xbits); + if (stree) s->static_len += (ulg)f * (unsigned)(stree[n].Len + xbits); + } + if (overflow == 0) return; + + Tracev((stderr,"\nbit length overflow\n")); + /* This happens for example on obj2 and pic of the Calgary corpus */ + + /* Find the first bit length which could increase: */ + do { + bits = max_length-1; + while (s->bl_count[bits] == 0) bits--; + s->bl_count[bits]--; /* move one leaf down the tree */ + s->bl_count[bits+1] += 2; /* move one overflow item as its brother */ + s->bl_count[max_length]--; + /* The brother of the overflow item also moves one step up, + * but this does not affect bl_count[max_length] + */ + overflow -= 2; + } while (overflow > 0); + + /* Now recompute all bit lengths, scanning in increasing frequency. + * h is still equal to HEAP_SIZE. (It is simpler to reconstruct all + * lengths instead of fixing only the wrong ones. This idea is taken + * from 'ar' written by Haruhiko Okumura.) + */ + for (bits = max_length; bits != 0; bits--) { + n = s->bl_count[bits]; + while (n != 0) { + m = s->heap[--h]; + if (m > max_code) continue; + if ((unsigned) tree[m].Len != (unsigned) bits) { + Tracev((stderr,"code %d bits %d->%d\n", m, tree[m].Len, bits)); + s->opt_len += ((ulg)bits - tree[m].Len) * tree[m].Freq; + tree[m].Len = (ush)bits; + } + n--; + } + } +} + +/* =========================================================================== + * Generate the codes for a given tree and bit counts (which need not be + * optimal). + * IN assertion: the array bl_count contains the bit length statistics for + * the given tree and the field len is set for all tree elements. + * OUT assertion: the field code is set for all tree elements of non + * zero code length. + */ +local void gen_codes (tree, max_code, bl_count) + ct_data *tree; /* the tree to decorate */ + int max_code; /* largest code with non zero frequency */ + ushf *bl_count; /* number of codes at each bit length */ +{ + ush next_code[MAX_BITS+1]; /* next code value for each bit length */ + unsigned code = 0; /* running code value */ + int bits; /* bit index */ + int n; /* code index */ + + /* The distribution counts are first used to generate the code values + * without bit reversal. + */ + for (bits = 1; bits <= MAX_BITS; bits++) { + code = (code + bl_count[bits-1]) << 1; + next_code[bits] = (ush)code; + } + /* Check that the bit counts in bl_count are consistent. The last code + * must be all ones. + */ + Assert (code + bl_count[MAX_BITS]-1 == (1<dyn_tree; + const ct_data *stree = desc->stat_desc->static_tree; + int elems = desc->stat_desc->elems; + int n, m; /* iterate over heap elements */ + int max_code = -1; /* largest code with non zero frequency */ + int node; /* new node being created */ + + /* Construct the initial heap, with least frequent element in + * heap[SMALLEST]. The sons of heap[n] are heap[2*n] and heap[2*n+1]. + * heap[0] is not used. + */ + s->heap_len = 0, s->heap_max = HEAP_SIZE; + + for (n = 0; n < elems; n++) { + if (tree[n].Freq != 0) { + s->heap[++(s->heap_len)] = max_code = n; + s->depth[n] = 0; + } else { + tree[n].Len = 0; + } + } + + /* The pkzip format requires that at least one distance code exists, + * and that at least one bit should be sent even if there is only one + * possible code. So to avoid special checks later on we force at least + * two codes of non zero frequency. + */ + while (s->heap_len < 2) { + node = s->heap[++(s->heap_len)] = (max_code < 2 ? ++max_code : 0); + tree[node].Freq = 1; + s->depth[node] = 0; + s->opt_len--; if (stree) s->static_len -= stree[node].Len; + /* node is 0 or 1 so it does not have extra bits */ + } + desc->max_code = max_code; + + /* The elements heap[heap_len/2+1 .. heap_len] are leaves of the tree, + * establish sub-heaps of increasing lengths: + */ + for (n = s->heap_len/2; n >= 1; n--) pqdownheap(s, tree, n); + + /* Construct the Huffman tree by repeatedly combining the least two + * frequent nodes. + */ + node = elems; /* next internal node of the tree */ + do { + pqremove(s, tree, n); /* n = node of least frequency */ + m = s->heap[SMALLEST]; /* m = node of next least frequency */ + + s->heap[--(s->heap_max)] = n; /* keep the nodes sorted by frequency */ + s->heap[--(s->heap_max)] = m; + + /* Create a new node father of n and m */ + tree[node].Freq = tree[n].Freq + tree[m].Freq; + s->depth[node] = (uch)((s->depth[n] >= s->depth[m] ? + s->depth[n] : s->depth[m]) + 1); + tree[n].Dad = tree[m].Dad = (ush)node; +#ifdef DUMP_BL_TREE + if (tree == s->bl_tree) { + fprintf(stderr,"\nnode %d(%d), sons %d(%d) %d(%d)", + node, tree[node].Freq, n, tree[n].Freq, m, tree[m].Freq); + } +#endif + /* and insert the new node in the heap */ + s->heap[SMALLEST] = node++; + pqdownheap(s, tree, SMALLEST); + + } while (s->heap_len >= 2); + + s->heap[--(s->heap_max)] = s->heap[SMALLEST]; + + /* At this point, the fields freq and dad are set. We can now + * generate the bit lengths. + */ + gen_bitlen(s, (tree_desc *)desc); + + /* The field len is now set, we can generate the bit codes */ + gen_codes ((ct_data *)tree, max_code, s->bl_count); +} + +/* =========================================================================== + * Scan a literal or distance tree to determine the frequencies of the codes + * in the bit length tree. + */ +local void scan_tree (s, tree, max_code) + deflate_state *s; + ct_data *tree; /* the tree to be scanned */ + int max_code; /* and its largest code of non zero frequency */ +{ + int n; /* iterates over all tree elements */ + int prevlen = -1; /* last emitted length */ + int curlen; /* length of current code */ + int nextlen = tree[0].Len; /* length of next code */ + int count = 0; /* repeat count of the current code */ + int max_count = 7; /* max repeat count */ + int min_count = 4; /* min repeat count */ + + if (nextlen == 0) max_count = 138, min_count = 3; + tree[max_code+1].Len = (ush)0xffff; /* guard */ + + for (n = 0; n <= max_code; n++) { + curlen = nextlen; nextlen = tree[n+1].Len; + if (++count < max_count && curlen == nextlen) { + continue; + } else if (count < min_count) { + s->bl_tree[curlen].Freq += count; + } else if (curlen != 0) { + if (curlen != prevlen) s->bl_tree[curlen].Freq++; + s->bl_tree[REP_3_6].Freq++; + } else if (count <= 10) { + s->bl_tree[REPZ_3_10].Freq++; + } else { + s->bl_tree[REPZ_11_138].Freq++; + } + count = 0; prevlen = curlen; + if (nextlen == 0) { + max_count = 138, min_count = 3; + } else if (curlen == nextlen) { + max_count = 6, min_count = 3; + } else { + max_count = 7, min_count = 4; + } + } +} + +/* =========================================================================== + * Send a literal or distance tree in compressed form, using the codes in + * bl_tree. + */ +local void send_tree (s, tree, max_code) + deflate_state *s; + ct_data *tree; /* the tree to be scanned */ + int max_code; /* and its largest code of non zero frequency */ +{ + int n; /* iterates over all tree elements */ + int prevlen = -1; /* last emitted length */ + int curlen; /* length of current code */ + int nextlen = tree[0].Len; /* length of next code */ + int count = 0; /* repeat count of the current code */ + int max_count = 7; /* max repeat count */ + int min_count = 4; /* min repeat count */ + + /* tree[max_code+1].Len = -1; */ /* guard already set */ + if (nextlen == 0) max_count = 138, min_count = 3; + + for (n = 0; n <= max_code; n++) { + curlen = nextlen; nextlen = tree[n+1].Len; + if (++count < max_count && curlen == nextlen) { + continue; + } else if (count < min_count) { + do { send_code(s, curlen, s->bl_tree); } while (--count != 0); + + } else if (curlen != 0) { + if (curlen != prevlen) { + send_code(s, curlen, s->bl_tree); count--; + } + Assert(count >= 3 && count <= 6, " 3_6?"); + send_code(s, REP_3_6, s->bl_tree); send_bits(s, count-3, 2); + + } else if (count <= 10) { + send_code(s, REPZ_3_10, s->bl_tree); send_bits(s, count-3, 3); + + } else { + send_code(s, REPZ_11_138, s->bl_tree); send_bits(s, count-11, 7); + } + count = 0; prevlen = curlen; + if (nextlen == 0) { + max_count = 138, min_count = 3; + } else if (curlen == nextlen) { + max_count = 6, min_count = 3; + } else { + max_count = 7, min_count = 4; + } + } +} + +/* =========================================================================== + * Construct the Huffman tree for the bit lengths and return the index in + * bl_order of the last bit length code to send. + */ +local int build_bl_tree(s) + deflate_state *s; +{ + int max_blindex; /* index of last bit length code of non zero freq */ + + /* Determine the bit length frequencies for literal and distance trees */ + scan_tree(s, (ct_data *)s->dyn_ltree, s->l_desc.max_code); + scan_tree(s, (ct_data *)s->dyn_dtree, s->d_desc.max_code); + + /* Build the bit length tree: */ + build_tree(s, (tree_desc *)(&(s->bl_desc))); + /* opt_len now includes the length of the tree representations, except + * the lengths of the bit lengths codes and the 5+5+4 bits for the counts. + */ + + /* Determine the number of bit length codes to send. The pkzip format + * requires that at least 4 bit length codes be sent. (appnote.txt says + * 3 but the actual value used is 4.) + */ + for (max_blindex = BL_CODES-1; max_blindex >= 3; max_blindex--) { + if (s->bl_tree[bl_order[max_blindex]].Len != 0) break; + } + /* Update opt_len to include the bit length tree and counts */ + s->opt_len += 3*((ulg)max_blindex+1) + 5+5+4; + Tracev((stderr, "\ndyn trees: dyn %ld, stat %ld", + s->opt_len, s->static_len)); + + return max_blindex; +} + +/* =========================================================================== + * Send the header for a block using dynamic Huffman trees: the counts, the + * lengths of the bit length codes, the literal tree and the distance tree. + * IN assertion: lcodes >= 257, dcodes >= 1, blcodes >= 4. + */ +local void send_all_trees(s, lcodes, dcodes, blcodes) + deflate_state *s; + int lcodes, dcodes, blcodes; /* number of codes for each tree */ +{ + int rank; /* index in bl_order */ + + Assert (lcodes >= 257 && dcodes >= 1 && blcodes >= 4, "not enough codes"); + Assert (lcodes <= L_CODES && dcodes <= D_CODES && blcodes <= BL_CODES, + "too many codes"); + Tracev((stderr, "\nbl counts: ")); + send_bits(s, lcodes-257, 5); /* not +255 as stated in appnote.txt */ + send_bits(s, dcodes-1, 5); + send_bits(s, blcodes-4, 4); /* not -3 as stated in appnote.txt */ + for (rank = 0; rank < blcodes; rank++) { + Tracev((stderr, "\nbl code %2d ", bl_order[rank])); + send_bits(s, s->bl_tree[bl_order[rank]].Len, 3); + } + Tracev((stderr, "\nbl tree: sent %ld", s->bits_sent)); + + send_tree(s, (ct_data *)s->dyn_ltree, lcodes-1); /* literal tree */ + Tracev((stderr, "\nlit tree: sent %ld", s->bits_sent)); + + send_tree(s, (ct_data *)s->dyn_dtree, dcodes-1); /* distance tree */ + Tracev((stderr, "\ndist tree: sent %ld", s->bits_sent)); +} + +/* =========================================================================== + * Send a stored block + */ +void ZLIB_INTERNAL _tr_stored_block(s, buf, stored_len, last) + deflate_state *s; + charf *buf; /* input block */ + ulg stored_len; /* length of input block */ + int last; /* one if this is the last block for a file */ +{ + send_bits(s, (STORED_BLOCK<<1)+last, 3); /* send block type */ + bi_windup(s); /* align on byte boundary */ + put_short(s, (ush)stored_len); + put_short(s, (ush)~stored_len); + zmemcpy(s->pending_buf + s->pending, (Bytef *)buf, stored_len); + s->pending += stored_len; +#ifdef ZLIB_DEBUG + s->compressed_len = (s->compressed_len + 3 + 7) & (ulg)~7L; + s->compressed_len += (stored_len + 4) << 3; + s->bits_sent += 2*16; + s->bits_sent += stored_len<<3; +#endif +} + +/* =========================================================================== + * Flush the bits in the bit buffer to pending output (leaves at most 7 bits) + */ +void ZLIB_INTERNAL _tr_flush_bits(s) + deflate_state *s; +{ + bi_flush(s); +} + +/* =========================================================================== + * Send one empty static block to give enough lookahead for inflate. + * This takes 10 bits, of which 7 may remain in the bit buffer. + */ +void ZLIB_INTERNAL _tr_align(s) + deflate_state *s; +{ + send_bits(s, STATIC_TREES<<1, 3); + send_code(s, END_BLOCK, static_ltree); +#ifdef ZLIB_DEBUG + s->compressed_len += 10L; /* 3 for block type, 7 for EOB */ +#endif + bi_flush(s); +} + +/* =========================================================================== + * Determine the best encoding for the current block: dynamic trees, static + * trees or store, and write out the encoded block. + */ +void ZLIB_INTERNAL _tr_flush_block(s, buf, stored_len, last) + deflate_state *s; + charf *buf; /* input block, or NULL if too old */ + ulg stored_len; /* length of input block */ + int last; /* one if this is the last block for a file */ +{ + ulg opt_lenb, static_lenb; /* opt_len and static_len in bytes */ + int max_blindex = 0; /* index of last bit length code of non zero freq */ + + /* Build the Huffman trees unless a stored block is forced */ + if (s->level > 0) { + + /* Check if the file is binary or text */ + if (s->strm->data_type == Z_UNKNOWN) + s->strm->data_type = detect_data_type(s); + + /* Construct the literal and distance trees */ + build_tree(s, (tree_desc *)(&(s->l_desc))); + Tracev((stderr, "\nlit data: dyn %ld, stat %ld", s->opt_len, + s->static_len)); + + build_tree(s, (tree_desc *)(&(s->d_desc))); + Tracev((stderr, "\ndist data: dyn %ld, stat %ld", s->opt_len, + s->static_len)); + /* At this point, opt_len and static_len are the total bit lengths of + * the compressed block data, excluding the tree representations. + */ + + /* Build the bit length tree for the above two trees, and get the index + * in bl_order of the last bit length code to send. + */ + max_blindex = build_bl_tree(s); + + /* Determine the best encoding. Compute the block lengths in bytes. */ + opt_lenb = (s->opt_len+3+7)>>3; + static_lenb = (s->static_len+3+7)>>3; + + Tracev((stderr, "\nopt %lu(%lu) stat %lu(%lu) stored %lu lit %u ", + opt_lenb, s->opt_len, static_lenb, s->static_len, stored_len, + s->last_lit)); + + if (static_lenb <= opt_lenb) opt_lenb = static_lenb; + + } else { + Assert(buf != (char*)0, "lost buf"); + opt_lenb = static_lenb = stored_len + 5; /* force a stored block */ + } + +#ifdef FORCE_STORED + if (buf != (char*)0) { /* force stored block */ +#else + if (stored_len+4 <= opt_lenb && buf != (char*)0) { + /* 4: two words for the lengths */ +#endif + /* The test buf != NULL is only necessary if LIT_BUFSIZE > WSIZE. + * Otherwise we can't have processed more than WSIZE input bytes since + * the last block flush, because compression would have been + * successful. If LIT_BUFSIZE <= WSIZE, it is never too late to + * transform a block into a stored block. + */ + _tr_stored_block(s, buf, stored_len, last); + +#ifdef FORCE_STATIC + } else if (static_lenb >= 0) { /* force static trees */ +#else + } else if (s->strategy == Z_FIXED || static_lenb == opt_lenb) { +#endif + send_bits(s, (STATIC_TREES<<1)+last, 3); + compress_block(s, (const ct_data *)static_ltree, + (const ct_data *)static_dtree); +#ifdef ZLIB_DEBUG + s->compressed_len += 3 + s->static_len; +#endif + } else { + send_bits(s, (DYN_TREES<<1)+last, 3); + send_all_trees(s, s->l_desc.max_code+1, s->d_desc.max_code+1, + max_blindex+1); + compress_block(s, (const ct_data *)s->dyn_ltree, + (const ct_data *)s->dyn_dtree); +#ifdef ZLIB_DEBUG + s->compressed_len += 3 + s->opt_len; +#endif + } + Assert (s->compressed_len == s->bits_sent, "bad compressed size"); + /* The above check is made mod 2^32, for files larger than 512 MB + * and uLong implemented on 32 bits. + */ + init_block(s); + + if (last) { + bi_windup(s); +#ifdef ZLIB_DEBUG + s->compressed_len += 7; /* align on byte boundary */ +#endif + } + Tracev((stderr,"\ncomprlen %lu(%lu) ", s->compressed_len>>3, + s->compressed_len-7*last)); +} + +/* =========================================================================== + * Save the match info and tally the frequency counts. Return true if + * the current block must be flushed. + */ +int ZLIB_INTERNAL _tr_tally (s, dist, lc) + deflate_state *s; + unsigned dist; /* distance of matched string */ + unsigned lc; /* match length-MIN_MATCH or unmatched char (if dist==0) */ +{ + s->d_buf[s->last_lit] = (ush)dist; + s->l_buf[s->last_lit++] = (uch)lc; + if (dist == 0) { + /* lc is the unmatched char */ + s->dyn_ltree[lc].Freq++; + } else { + s->matches++; + /* Here, lc is the match length - MIN_MATCH */ + dist--; /* dist = match distance - 1 */ + Assert((ush)dist < (ush)MAX_DIST(s) && + (ush)lc <= (ush)(MAX_MATCH-MIN_MATCH) && + (ush)d_code(dist) < (ush)D_CODES, "_tr_tally: bad match"); + + s->dyn_ltree[_length_code[lc]+LITERALS+1].Freq++; + s->dyn_dtree[d_code(dist)].Freq++; + } + +#ifdef TRUNCATE_BLOCK + /* Try to guess if it is profitable to stop the current block here */ + if ((s->last_lit & 0x1fff) == 0 && s->level > 2) { + /* Compute an upper bound for the compressed length */ + ulg out_length = (ulg)s->last_lit*8L; + ulg in_length = (ulg)((long)s->strstart - s->block_start); + int dcode; + for (dcode = 0; dcode < D_CODES; dcode++) { + out_length += (ulg)s->dyn_dtree[dcode].Freq * + (5L+extra_dbits[dcode]); + } + out_length >>= 3; + Tracev((stderr,"\nlast_lit %u, in %ld, out ~%ld(%ld%%) ", + s->last_lit, in_length, out_length, + 100L - out_length*100L/in_length)); + if (s->matches < s->last_lit/2 && out_length < in_length/2) return 1; + } +#endif + return (s->last_lit == s->lit_bufsize-1); + /* We avoid equality with lit_bufsize because of wraparound at 64K + * on 16 bit machines and because stored blocks are restricted to + * 64K-1 bytes. + */ +} + +/* =========================================================================== + * Send the block data compressed using the given Huffman trees + */ +local void compress_block(s, ltree, dtree) + deflate_state *s; + const ct_data *ltree; /* literal tree */ + const ct_data *dtree; /* distance tree */ +{ + unsigned dist; /* distance of matched string */ + int lc; /* match length or unmatched char (if dist == 0) */ + unsigned lx = 0; /* running index in l_buf */ + unsigned code; /* the code to send */ + int extra; /* number of extra bits to send */ + + if (s->last_lit != 0) do { + dist = s->d_buf[lx]; + lc = s->l_buf[lx++]; + if (dist == 0) { + send_code(s, lc, ltree); /* send a literal byte */ + Tracecv(isgraph(lc), (stderr," '%c' ", lc)); + } else { + /* Here, lc is the match length - MIN_MATCH */ + code = _length_code[lc]; + send_code(s, code+LITERALS+1, ltree); /* send the length code */ + extra = extra_lbits[code]; + if (extra != 0) { + lc -= base_length[code]; + send_bits(s, lc, extra); /* send the extra length bits */ + } + dist--; /* dist is now the match distance - 1 */ + code = d_code(dist); + Assert (code < D_CODES, "bad d_code"); + + send_code(s, code, dtree); /* send the distance code */ + extra = extra_dbits[code]; + if (extra != 0) { + dist -= (unsigned)base_dist[code]; + send_bits(s, dist, extra); /* send the extra distance bits */ + } + } /* literal or match pair ? */ + + /* Check that the overlay between pending_buf and d_buf+l_buf is ok: */ + Assert((uInt)(s->pending) < s->lit_bufsize + 2*lx, + "pendingBuf overflow"); + + } while (lx < s->last_lit); + + send_code(s, END_BLOCK, ltree); +} + +/* =========================================================================== + * Check if the data type is TEXT or BINARY, using the following algorithm: + * - TEXT if the two conditions below are satisfied: + * a) There are no non-portable control characters belonging to the + * "black list" (0..6, 14..25, 28..31). + * b) There is at least one printable character belonging to the + * "white list" (9 {TAB}, 10 {LF}, 13 {CR}, 32..255). + * - BINARY otherwise. + * - The following partially-portable control characters form a + * "gray list" that is ignored in this detection algorithm: + * (7 {BEL}, 8 {BS}, 11 {VT}, 12 {FF}, 26 {SUB}, 27 {ESC}). + * IN assertion: the fields Freq of dyn_ltree are set. + */ +local int detect_data_type(s) + deflate_state *s; +{ + /* black_mask is the bit mask of black-listed bytes + * set bits 0..6, 14..25, and 28..31 + * 0xf3ffc07f = binary 11110011111111111100000001111111 + */ + unsigned long black_mask = 0xf3ffc07fUL; + int n; + + /* Check for non-textual ("black-listed") bytes. */ + for (n = 0; n <= 31; n++, black_mask >>= 1) + if ((black_mask & 1) && (s->dyn_ltree[n].Freq != 0)) + return Z_BINARY; + + /* Check for textual ("white-listed") bytes. */ + if (s->dyn_ltree[9].Freq != 0 || s->dyn_ltree[10].Freq != 0 + || s->dyn_ltree[13].Freq != 0) + return Z_TEXT; + for (n = 32; n < LITERALS; n++) + if (s->dyn_ltree[n].Freq != 0) + return Z_TEXT; + + /* There are no "black-listed" or "white-listed" bytes: + * this stream either is empty or has tolerated ("gray-listed") bytes only. + */ + return Z_BINARY; +} + +/* =========================================================================== + * Reverse the first len bits of a code, using straightforward code (a faster + * method would use a table) + * IN assertion: 1 <= len <= 15 + */ +local unsigned bi_reverse(code, len) + unsigned code; /* the value to invert */ + int len; /* its bit length */ +{ + register unsigned res = 0; + do { + res |= code & 1; + code >>= 1, res <<= 1; + } while (--len > 0); + return res >> 1; +} + +/* =========================================================================== + * Flush the bit buffer, keeping at most 7 bits in it. + */ +local void bi_flush(s) + deflate_state *s; +{ + if (s->bi_valid == 16) { + put_short(s, s->bi_buf); + s->bi_buf = 0; + s->bi_valid = 0; + } else if (s->bi_valid >= 8) { + put_byte(s, (Byte)s->bi_buf); + s->bi_buf >>= 8; + s->bi_valid -= 8; + } +} + +/* =========================================================================== + * Flush the bit buffer and align the output on a byte boundary + */ +local void bi_windup(s) + deflate_state *s; +{ + if (s->bi_valid > 8) { + put_short(s, s->bi_buf); + } else if (s->bi_valid > 0) { + put_byte(s, (Byte)s->bi_buf); + } + s->bi_buf = 0; + s->bi_valid = 0; +#ifdef ZLIB_DEBUG + s->bits_sent = (s->bits_sent+7) & ~7; +#endif +} diff --git a/PdbChecker/zlib/trees.h b/PdbChecker/zlib/trees.h new file mode 100644 index 0000000..d35639d --- /dev/null +++ b/PdbChecker/zlib/trees.h @@ -0,0 +1,128 @@ +/* header created automatically with -DGEN_TREES_H */ + +local const ct_data static_ltree[L_CODES+2] = { +{{ 12},{ 8}}, {{140},{ 8}}, {{ 76},{ 8}}, {{204},{ 8}}, {{ 44},{ 8}}, +{{172},{ 8}}, {{108},{ 8}}, {{236},{ 8}}, {{ 28},{ 8}}, {{156},{ 8}}, +{{ 92},{ 8}}, {{220},{ 8}}, {{ 60},{ 8}}, {{188},{ 8}}, {{124},{ 8}}, +{{252},{ 8}}, {{ 2},{ 8}}, {{130},{ 8}}, {{ 66},{ 8}}, {{194},{ 8}}, +{{ 34},{ 8}}, {{162},{ 8}}, {{ 98},{ 8}}, {{226},{ 8}}, {{ 18},{ 8}}, +{{146},{ 8}}, {{ 82},{ 8}}, {{210},{ 8}}, {{ 50},{ 8}}, {{178},{ 8}}, +{{114},{ 8}}, {{242},{ 8}}, {{ 10},{ 8}}, {{138},{ 8}}, {{ 74},{ 8}}, +{{202},{ 8}}, {{ 42},{ 8}}, {{170},{ 8}}, {{106},{ 8}}, {{234},{ 8}}, +{{ 26},{ 8}}, {{154},{ 8}}, {{ 90},{ 8}}, {{218},{ 8}}, {{ 58},{ 8}}, +{{186},{ 8}}, {{122},{ 8}}, {{250},{ 8}}, {{ 6},{ 8}}, {{134},{ 8}}, +{{ 70},{ 8}}, {{198},{ 8}}, {{ 38},{ 8}}, {{166},{ 8}}, {{102},{ 8}}, +{{230},{ 8}}, {{ 22},{ 8}}, {{150},{ 8}}, {{ 86},{ 8}}, {{214},{ 8}}, +{{ 54},{ 8}}, {{182},{ 8}}, {{118},{ 8}}, {{246},{ 8}}, {{ 14},{ 8}}, +{{142},{ 8}}, {{ 78},{ 8}}, {{206},{ 8}}, {{ 46},{ 8}}, {{174},{ 8}}, +{{110},{ 8}}, {{238},{ 8}}, {{ 30},{ 8}}, {{158},{ 8}}, {{ 94},{ 8}}, +{{222},{ 8}}, {{ 62},{ 8}}, {{190},{ 8}}, {{126},{ 8}}, {{254},{ 8}}, +{{ 1},{ 8}}, {{129},{ 8}}, {{ 65},{ 8}}, {{193},{ 8}}, {{ 33},{ 8}}, +{{161},{ 8}}, {{ 97},{ 8}}, {{225},{ 8}}, {{ 17},{ 8}}, {{145},{ 8}}, +{{ 81},{ 8}}, {{209},{ 8}}, {{ 49},{ 8}}, {{177},{ 8}}, {{113},{ 8}}, +{{241},{ 8}}, {{ 9},{ 8}}, {{137},{ 8}}, {{ 73},{ 8}}, {{201},{ 8}}, +{{ 41},{ 8}}, {{169},{ 8}}, {{105},{ 8}}, {{233},{ 8}}, {{ 25},{ 8}}, +{{153},{ 8}}, {{ 89},{ 8}}, {{217},{ 8}}, {{ 57},{ 8}}, {{185},{ 8}}, +{{121},{ 8}}, {{249},{ 8}}, {{ 5},{ 8}}, {{133},{ 8}}, {{ 69},{ 8}}, +{{197},{ 8}}, {{ 37},{ 8}}, {{165},{ 8}}, {{101},{ 8}}, {{229},{ 8}}, +{{ 21},{ 8}}, {{149},{ 8}}, {{ 85},{ 8}}, {{213},{ 8}}, {{ 53},{ 8}}, +{{181},{ 8}}, {{117},{ 8}}, {{245},{ 8}}, {{ 13},{ 8}}, {{141},{ 8}}, +{{ 77},{ 8}}, {{205},{ 8}}, {{ 45},{ 8}}, {{173},{ 8}}, {{109},{ 8}}, +{{237},{ 8}}, {{ 29},{ 8}}, {{157},{ 8}}, {{ 93},{ 8}}, {{221},{ 8}}, +{{ 61},{ 8}}, {{189},{ 8}}, {{125},{ 8}}, {{253},{ 8}}, {{ 19},{ 9}}, +{{275},{ 9}}, {{147},{ 9}}, {{403},{ 9}}, {{ 83},{ 9}}, {{339},{ 9}}, +{{211},{ 9}}, {{467},{ 9}}, {{ 51},{ 9}}, {{307},{ 9}}, {{179},{ 9}}, +{{435},{ 9}}, {{115},{ 9}}, {{371},{ 9}}, {{243},{ 9}}, {{499},{ 9}}, +{{ 11},{ 9}}, {{267},{ 9}}, {{139},{ 9}}, {{395},{ 9}}, {{ 75},{ 9}}, +{{331},{ 9}}, {{203},{ 9}}, {{459},{ 9}}, {{ 43},{ 9}}, {{299},{ 9}}, +{{171},{ 9}}, {{427},{ 9}}, {{107},{ 9}}, {{363},{ 9}}, {{235},{ 9}}, +{{491},{ 9}}, {{ 27},{ 9}}, {{283},{ 9}}, {{155},{ 9}}, {{411},{ 9}}, +{{ 91},{ 9}}, {{347},{ 9}}, {{219},{ 9}}, {{475},{ 9}}, {{ 59},{ 9}}, +{{315},{ 9}}, {{187},{ 9}}, {{443},{ 9}}, {{123},{ 9}}, {{379},{ 9}}, +{{251},{ 9}}, {{507},{ 9}}, {{ 7},{ 9}}, {{263},{ 9}}, {{135},{ 9}}, +{{391},{ 9}}, {{ 71},{ 9}}, {{327},{ 9}}, {{199},{ 9}}, {{455},{ 9}}, +{{ 39},{ 9}}, {{295},{ 9}}, {{167},{ 9}}, {{423},{ 9}}, {{103},{ 9}}, +{{359},{ 9}}, {{231},{ 9}}, {{487},{ 9}}, {{ 23},{ 9}}, {{279},{ 9}}, +{{151},{ 9}}, {{407},{ 9}}, {{ 87},{ 9}}, {{343},{ 9}}, {{215},{ 9}}, +{{471},{ 9}}, {{ 55},{ 9}}, {{311},{ 9}}, {{183},{ 9}}, {{439},{ 9}}, +{{119},{ 9}}, {{375},{ 9}}, {{247},{ 9}}, {{503},{ 9}}, {{ 15},{ 9}}, +{{271},{ 9}}, {{143},{ 9}}, {{399},{ 9}}, {{ 79},{ 9}}, {{335},{ 9}}, +{{207},{ 9}}, {{463},{ 9}}, {{ 47},{ 9}}, {{303},{ 9}}, {{175},{ 9}}, +{{431},{ 9}}, {{111},{ 9}}, {{367},{ 9}}, {{239},{ 9}}, {{495},{ 9}}, +{{ 31},{ 9}}, {{287},{ 9}}, {{159},{ 9}}, {{415},{ 9}}, {{ 95},{ 9}}, +{{351},{ 9}}, {{223},{ 9}}, {{479},{ 9}}, {{ 63},{ 9}}, {{319},{ 9}}, +{{191},{ 9}}, {{447},{ 9}}, {{127},{ 9}}, {{383},{ 9}}, {{255},{ 9}}, +{{511},{ 9}}, {{ 0},{ 7}}, {{ 64},{ 7}}, {{ 32},{ 7}}, {{ 96},{ 7}}, +{{ 16},{ 7}}, {{ 80},{ 7}}, {{ 48},{ 7}}, {{112},{ 7}}, {{ 8},{ 7}}, +{{ 72},{ 7}}, {{ 40},{ 7}}, {{104},{ 7}}, {{ 24},{ 7}}, {{ 88},{ 7}}, +{{ 56},{ 7}}, {{120},{ 7}}, {{ 4},{ 7}}, {{ 68},{ 7}}, {{ 36},{ 7}}, +{{100},{ 7}}, {{ 20},{ 7}}, {{ 84},{ 7}}, {{ 52},{ 7}}, {{116},{ 7}}, +{{ 3},{ 8}}, {{131},{ 8}}, {{ 67},{ 8}}, {{195},{ 8}}, {{ 35},{ 8}}, +{{163},{ 8}}, {{ 99},{ 8}}, {{227},{ 8}} +}; + +local const ct_data static_dtree[D_CODES] = { +{{ 0},{ 5}}, {{16},{ 5}}, {{ 8},{ 5}}, {{24},{ 5}}, {{ 4},{ 5}}, +{{20},{ 5}}, {{12},{ 5}}, {{28},{ 5}}, {{ 2},{ 5}}, {{18},{ 5}}, +{{10},{ 5}}, {{26},{ 5}}, {{ 6},{ 5}}, {{22},{ 5}}, {{14},{ 5}}, +{{30},{ 5}}, {{ 1},{ 5}}, {{17},{ 5}}, {{ 9},{ 5}}, {{25},{ 5}}, +{{ 5},{ 5}}, {{21},{ 5}}, {{13},{ 5}}, {{29},{ 5}}, {{ 3},{ 5}}, +{{19},{ 5}}, {{11},{ 5}}, {{27},{ 5}}, {{ 7},{ 5}}, {{23},{ 5}} +}; + +const uch ZLIB_INTERNAL _dist_code[DIST_CODE_LEN] = { + 0, 1, 2, 3, 4, 4, 5, 5, 6, 6, 6, 6, 7, 7, 7, 7, 8, 8, 8, 8, + 8, 8, 8, 8, 9, 9, 9, 9, 9, 9, 9, 9, 10, 10, 10, 10, 10, 10, 10, 10, +10, 10, 10, 10, 10, 10, 10, 10, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, +11, 11, 11, 11, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, +12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 12, 13, 13, 13, 13, +13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, +13, 13, 13, 13, 13, 13, 13, 13, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, +14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, +14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, +14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 14, 15, 15, 15, 15, 15, 15, 15, 15, +15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, +15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, +15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 15, 0, 0, 16, 17, +18, 18, 19, 19, 20, 20, 20, 20, 21, 21, 21, 21, 22, 22, 22, 22, 22, 22, 22, 22, +23, 23, 23, 23, 23, 23, 23, 23, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, +24, 24, 24, 24, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, +26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, +26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 27, 27, 27, 27, 27, 27, 27, 27, +27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, +27, 27, 27, 27, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, +28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, +28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, +28, 28, 28, 28, 28, 28, 28, 28, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, +29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, +29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, +29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29, 29 +}; + +const uch ZLIB_INTERNAL _length_code[MAX_MATCH-MIN_MATCH+1]= { + 0, 1, 2, 3, 4, 5, 6, 7, 8, 8, 9, 9, 10, 10, 11, 11, 12, 12, 12, 12, +13, 13, 13, 13, 14, 14, 14, 14, 15, 15, 15, 15, 16, 16, 16, 16, 16, 16, 16, 16, +17, 17, 17, 17, 17, 17, 17, 17, 18, 18, 18, 18, 18, 18, 18, 18, 19, 19, 19, 19, +19, 19, 19, 19, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, 20, +21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 21, 22, 22, 22, 22, +22, 22, 22, 22, 22, 22, 22, 22, 22, 22, 22, 22, 23, 23, 23, 23, 23, 23, 23, 23, +23, 23, 23, 23, 23, 23, 23, 23, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, +24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, +25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, +25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 25, 26, 26, 26, 26, 26, 26, 26, 26, +26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, 26, +26, 26, 26, 26, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, +27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 27, 28 +}; + +local const int base_length[LENGTH_CODES] = { +0, 1, 2, 3, 4, 5, 6, 7, 8, 10, 12, 14, 16, 20, 24, 28, 32, 40, 48, 56, +64, 80, 96, 112, 128, 160, 192, 224, 0 +}; + +local const int base_dist[D_CODES] = { + 0, 1, 2, 3, 4, 6, 8, 12, 16, 24, + 32, 48, 64, 96, 128, 192, 256, 384, 512, 768, + 1024, 1536, 2048, 3072, 4096, 6144, 8192, 12288, 16384, 24576 +}; + diff --git a/PdbChecker/zlib/uncompr.c b/PdbChecker/zlib/uncompr.c new file mode 100644 index 0000000..f03a1a8 --- /dev/null +++ b/PdbChecker/zlib/uncompr.c @@ -0,0 +1,93 @@ +/* uncompr.c -- decompress a memory buffer + * Copyright (C) 1995-2003, 2010, 2014, 2016 Jean-loup Gailly, Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* @(#) $Id$ */ + +#define ZLIB_INTERNAL +#include "zlib.h" + +/* =========================================================================== + Decompresses the source buffer into the destination buffer. *sourceLen is + the byte length of the source buffer. Upon entry, *destLen is the total size + of the destination buffer, which must be large enough to hold the entire + uncompressed data. (The size of the uncompressed data must have been saved + previously by the compressor and transmitted to the decompressor by some + mechanism outside the scope of this compression library.) Upon exit, + *destLen is the size of the decompressed data and *sourceLen is the number + of source bytes consumed. Upon return, source + *sourceLen points to the + first unused input byte. + + uncompress returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_BUF_ERROR if there was not enough room in the output buffer, or + Z_DATA_ERROR if the input data was corrupted, including if the input data is + an incomplete zlib stream. +*/ +int ZEXPORT uncompress2 (dest, destLen, source, sourceLen) + Bytef *dest; + uLongf *destLen; + const Bytef *source; + uLong *sourceLen; +{ + z_stream stream; + int err; + const uInt max = (uInt)-1; + uLong len, left; + Byte buf[1]; /* for detection of incomplete stream when *destLen == 0 */ + + len = *sourceLen; + if (*destLen) { + left = *destLen; + *destLen = 0; + } + else { + left = 1; + dest = buf; + } + + stream.next_in = (z_const Bytef *)source; + stream.avail_in = 0; + stream.zalloc = (alloc_func)0; + stream.zfree = (free_func)0; + stream.opaque = (voidpf)0; + + err = inflateInit(&stream); + if (err != Z_OK) return err; + + stream.next_out = dest; + stream.avail_out = 0; + + do { + if (stream.avail_out == 0) { + stream.avail_out = left > (uLong)max ? max : (uInt)left; + left -= stream.avail_out; + } + if (stream.avail_in == 0) { + stream.avail_in = len > (uLong)max ? max : (uInt)len; + len -= stream.avail_in; + } + err = inflate(&stream, Z_NO_FLUSH); + } while (err == Z_OK); + + *sourceLen -= len + stream.avail_in; + if (dest != buf) + *destLen = stream.total_out; + else if (stream.total_out && err == Z_BUF_ERROR) + left = 1; + + inflateEnd(&stream); + return err == Z_STREAM_END ? Z_OK : + err == Z_NEED_DICT ? Z_DATA_ERROR : + err == Z_BUF_ERROR && left + stream.avail_out ? Z_DATA_ERROR : + err; +} + +int ZEXPORT uncompress (dest, destLen, source, sourceLen) + Bytef *dest; + uLongf *destLen; + const Bytef *source; + uLong sourceLen; +{ + return uncompress2(dest, destLen, source, &sourceLen); +} diff --git a/PdbChecker/zlib/zconf.h b/PdbChecker/zlib/zconf.h new file mode 100644 index 0000000..5e1d68a --- /dev/null +++ b/PdbChecker/zlib/zconf.h @@ -0,0 +1,534 @@ +/* zconf.h -- configuration of the zlib compression library + * Copyright (C) 1995-2016 Jean-loup Gailly, Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* @(#) $Id$ */ + +#ifndef ZCONF_H +#define ZCONF_H + +/* + * If you *really* need a unique prefix for all types and library functions, + * compile with -DZ_PREFIX. The "standard" zlib should be compiled without it. + * Even better than compiling with -DZ_PREFIX would be to use configure to set + * this permanently in zconf.h using "./configure --zprefix". + */ +#ifdef Z_PREFIX /* may be set to #if 1 by ./configure */ +# define Z_PREFIX_SET + +/* all linked symbols and init macros */ +# define _dist_code z__dist_code +# define _length_code z__length_code +# define _tr_align z__tr_align +# define _tr_flush_bits z__tr_flush_bits +# define _tr_flush_block z__tr_flush_block +# define _tr_init z__tr_init +# define _tr_stored_block z__tr_stored_block +# define _tr_tally z__tr_tally +# define adler32 z_adler32 +# define adler32_combine z_adler32_combine +# define adler32_combine64 z_adler32_combine64 +# define adler32_z z_adler32_z +# ifndef Z_SOLO +# define compress z_compress +# define compress2 z_compress2 +# define compressBound z_compressBound +# endif +# define crc32 z_crc32 +# define crc32_combine z_crc32_combine +# define crc32_combine64 z_crc32_combine64 +# define crc32_z z_crc32_z +# define deflate z_deflate +# define deflateBound z_deflateBound +# define deflateCopy z_deflateCopy +# define deflateEnd z_deflateEnd +# define deflateGetDictionary z_deflateGetDictionary +# define deflateInit z_deflateInit +# define deflateInit2 z_deflateInit2 +# define deflateInit2_ z_deflateInit2_ +# define deflateInit_ z_deflateInit_ +# define deflateParams z_deflateParams +# define deflatePending z_deflatePending +# define deflatePrime z_deflatePrime +# define deflateReset z_deflateReset +# define deflateResetKeep z_deflateResetKeep +# define deflateSetDictionary z_deflateSetDictionary +# define deflateSetHeader z_deflateSetHeader +# define deflateTune z_deflateTune +# define deflate_copyright z_deflate_copyright +# define get_crc_table z_get_crc_table +# ifndef Z_SOLO +# define gz_error z_gz_error +# define gz_intmax z_gz_intmax +# define gz_strwinerror z_gz_strwinerror +# define gzbuffer z_gzbuffer +# define gzclearerr z_gzclearerr +# define gzclose z_gzclose +# define gzclose_r z_gzclose_r +# define gzclose_w z_gzclose_w +# define gzdirect z_gzdirect +# define gzdopen z_gzdopen +# define gzeof z_gzeof +# define gzerror z_gzerror +# define gzflush z_gzflush +# define gzfread z_gzfread +# define gzfwrite z_gzfwrite +# define gzgetc z_gzgetc +# define gzgetc_ z_gzgetc_ +# define gzgets z_gzgets +# define gzoffset z_gzoffset +# define gzoffset64 z_gzoffset64 +# define gzopen z_gzopen +# define gzopen64 z_gzopen64 +# ifdef _WIN32 +# define gzopen_w z_gzopen_w +# endif +# define gzprintf z_gzprintf +# define gzputc z_gzputc +# define gzputs z_gzputs +# define gzread z_gzread +# define gzrewind z_gzrewind +# define gzseek z_gzseek +# define gzseek64 z_gzseek64 +# define gzsetparams z_gzsetparams +# define gztell z_gztell +# define gztell64 z_gztell64 +# define gzungetc z_gzungetc +# define gzvprintf z_gzvprintf +# define gzwrite z_gzwrite +# endif +# define inflate z_inflate +# define inflateBack z_inflateBack +# define inflateBackEnd z_inflateBackEnd +# define inflateBackInit z_inflateBackInit +# define inflateBackInit_ z_inflateBackInit_ +# define inflateCodesUsed z_inflateCodesUsed +# define inflateCopy z_inflateCopy +# define inflateEnd z_inflateEnd +# define inflateGetDictionary z_inflateGetDictionary +# define inflateGetHeader z_inflateGetHeader +# define inflateInit z_inflateInit +# define inflateInit2 z_inflateInit2 +# define inflateInit2_ z_inflateInit2_ +# define inflateInit_ z_inflateInit_ +# define inflateMark z_inflateMark +# define inflatePrime z_inflatePrime +# define inflateReset z_inflateReset +# define inflateReset2 z_inflateReset2 +# define inflateResetKeep z_inflateResetKeep +# define inflateSetDictionary z_inflateSetDictionary +# define inflateSync z_inflateSync +# define inflateSyncPoint z_inflateSyncPoint +# define inflateUndermine z_inflateUndermine +# define inflateValidate z_inflateValidate +# define inflate_copyright z_inflate_copyright +# define inflate_fast z_inflate_fast +# define inflate_table z_inflate_table +# ifndef Z_SOLO +# define uncompress z_uncompress +# define uncompress2 z_uncompress2 +# endif +# define zError z_zError +# ifndef Z_SOLO +# define zcalloc z_zcalloc +# define zcfree z_zcfree +# endif +# define zlibCompileFlags z_zlibCompileFlags +# define zlibVersion z_zlibVersion + +/* all zlib typedefs in zlib.h and zconf.h */ +# define Byte z_Byte +# define Bytef z_Bytef +# define alloc_func z_alloc_func +# define charf z_charf +# define free_func z_free_func +# ifndef Z_SOLO +# define gzFile z_gzFile +# endif +# define gz_header z_gz_header +# define gz_headerp z_gz_headerp +# define in_func z_in_func +# define intf z_intf +# define out_func z_out_func +# define uInt z_uInt +# define uIntf z_uIntf +# define uLong z_uLong +# define uLongf z_uLongf +# define voidp z_voidp +# define voidpc z_voidpc +# define voidpf z_voidpf + +/* all zlib structs in zlib.h and zconf.h */ +# define gz_header_s z_gz_header_s +# define internal_state z_internal_state + +#endif + +#if defined(__MSDOS__) && !defined(MSDOS) +# define MSDOS +#endif +#if (defined(OS_2) || defined(__OS2__)) && !defined(OS2) +# define OS2 +#endif +#if defined(_WINDOWS) && !defined(WINDOWS) +# define WINDOWS +#endif +#if defined(_WIN32) || defined(_WIN32_WCE) || defined(__WIN32__) +# ifndef WIN32 +# define WIN32 +# endif +#endif +#if (defined(MSDOS) || defined(OS2) || defined(WINDOWS)) && !defined(WIN32) +# if !defined(__GNUC__) && !defined(__FLAT__) && !defined(__386__) +# ifndef SYS16BIT +# define SYS16BIT +# endif +# endif +#endif + +/* + * Compile with -DMAXSEG_64K if the alloc function cannot allocate more + * than 64k bytes at a time (needed on systems with 16-bit int). + */ +#ifdef SYS16BIT +# define MAXSEG_64K +#endif +#ifdef MSDOS +# define UNALIGNED_OK +#endif + +#ifdef __STDC_VERSION__ +# ifndef STDC +# define STDC +# endif +# if __STDC_VERSION__ >= 199901L +# ifndef STDC99 +# define STDC99 +# endif +# endif +#endif +#if !defined(STDC) && (defined(__STDC__) || defined(__cplusplus)) +# define STDC +#endif +#if !defined(STDC) && (defined(__GNUC__) || defined(__BORLANDC__)) +# define STDC +#endif +#if !defined(STDC) && (defined(MSDOS) || defined(WINDOWS) || defined(WIN32)) +# define STDC +#endif +#if !defined(STDC) && (defined(OS2) || defined(__HOS_AIX__)) +# define STDC +#endif + +#if defined(__OS400__) && !defined(STDC) /* iSeries (formerly AS/400). */ +# define STDC +#endif + +#ifndef STDC +# ifndef const /* cannot use !defined(STDC) && !defined(const) on Mac */ +# define const /* note: need a more gentle solution here */ +# endif +#endif + +#if defined(ZLIB_CONST) && !defined(z_const) +# define z_const const +#else +# define z_const +#endif + +#ifdef Z_SOLO + typedef unsigned long z_size_t; +#else +# define z_longlong long long +# if defined(NO_SIZE_T) + typedef unsigned NO_SIZE_T z_size_t; +# elif defined(STDC) +# include + typedef size_t z_size_t; +# else + typedef unsigned long z_size_t; +# endif +# undef z_longlong +#endif + +/* Maximum value for memLevel in deflateInit2 */ +#ifndef MAX_MEM_LEVEL +# ifdef MAXSEG_64K +# define MAX_MEM_LEVEL 8 +# else +# define MAX_MEM_LEVEL 9 +# endif +#endif + +/* Maximum value for windowBits in deflateInit2 and inflateInit2. + * WARNING: reducing MAX_WBITS makes minigzip unable to extract .gz files + * created by gzip. (Files created by minigzip can still be extracted by + * gzip.) + */ +#ifndef MAX_WBITS +# define MAX_WBITS 15 /* 32K LZ77 window */ +#endif + +/* The memory requirements for deflate are (in bytes): + (1 << (windowBits+2)) + (1 << (memLevel+9)) + that is: 128K for windowBits=15 + 128K for memLevel = 8 (default values) + plus a few kilobytes for small objects. For example, if you want to reduce + the default memory requirements from 256K to 128K, compile with + make CFLAGS="-O -DMAX_WBITS=14 -DMAX_MEM_LEVEL=7" + Of course this will generally degrade compression (there's no free lunch). + + The memory requirements for inflate are (in bytes) 1 << windowBits + that is, 32K for windowBits=15 (default value) plus about 7 kilobytes + for small objects. +*/ + + /* Type declarations */ + +#ifndef OF /* function prototypes */ +# ifdef STDC +# define OF(args) args +# else +# define OF(args) () +# endif +#endif + +#ifndef Z_ARG /* function prototypes for stdarg */ +# if defined(STDC) || defined(Z_HAVE_STDARG_H) +# define Z_ARG(args) args +# else +# define Z_ARG(args) () +# endif +#endif + +/* The following definitions for FAR are needed only for MSDOS mixed + * model programming (small or medium model with some far allocations). + * This was tested only with MSC; for other MSDOS compilers you may have + * to define NO_MEMCPY in zutil.h. If you don't need the mixed model, + * just define FAR to be empty. + */ +#ifdef SYS16BIT +# if defined(M_I86SM) || defined(M_I86MM) + /* MSC small or medium model */ +# define SMALL_MEDIUM +# ifdef _MSC_VER +# define FAR _far +# else +# define FAR far +# endif +# endif +# if (defined(__SMALL__) || defined(__MEDIUM__)) + /* Turbo C small or medium model */ +# define SMALL_MEDIUM +# ifdef __BORLANDC__ +# define FAR _far +# else +# define FAR far +# endif +# endif +#endif + +#if defined(WINDOWS) || defined(WIN32) + /* If building or using zlib as a DLL, define ZLIB_DLL. + * This is not mandatory, but it offers a little performance increase. + */ +# ifdef ZLIB_DLL +# if defined(WIN32) && (!defined(__BORLANDC__) || (__BORLANDC__ >= 0x500)) +# ifdef ZLIB_INTERNAL +# define ZEXTERN extern __declspec(dllexport) +# else +# define ZEXTERN extern __declspec(dllimport) +# endif +# endif +# endif /* ZLIB_DLL */ + /* If building or using zlib with the WINAPI/WINAPIV calling convention, + * define ZLIB_WINAPI. + * Caution: the standard ZLIB1.DLL is NOT compiled using ZLIB_WINAPI. + */ +# ifdef ZLIB_WINAPI +# ifdef FAR +# undef FAR +# endif +# include + /* No need for _export, use ZLIB.DEF instead. */ + /* For complete Windows compatibility, use WINAPI, not __stdcall. */ +# define ZEXPORT WINAPI +# ifdef WIN32 +# define ZEXPORTVA WINAPIV +# else +# define ZEXPORTVA FAR CDECL +# endif +# endif +#endif + +#if defined (__BEOS__) +# ifdef ZLIB_DLL +# ifdef ZLIB_INTERNAL +# define ZEXPORT __declspec(dllexport) +# define ZEXPORTVA __declspec(dllexport) +# else +# define ZEXPORT __declspec(dllimport) +# define ZEXPORTVA __declspec(dllimport) +# endif +# endif +#endif + +#ifndef ZEXTERN +# define ZEXTERN extern +#endif +#ifndef ZEXPORT +# define ZEXPORT +#endif +#ifndef ZEXPORTVA +# define ZEXPORTVA +#endif + +#ifndef FAR +# define FAR +#endif + +#if !defined(__MACTYPES__) +typedef unsigned char Byte; /* 8 bits */ +#endif +typedef unsigned int uInt; /* 16 bits or more */ +typedef unsigned long uLong; /* 32 bits or more */ + +#ifdef SMALL_MEDIUM + /* Borland C/C++ and some old MSC versions ignore FAR inside typedef */ +# define Bytef Byte FAR +#else + typedef Byte FAR Bytef; +#endif +typedef char FAR charf; +typedef int FAR intf; +typedef uInt FAR uIntf; +typedef uLong FAR uLongf; + +#ifdef STDC + typedef void const *voidpc; + typedef void FAR *voidpf; + typedef void *voidp; +#else + typedef Byte const *voidpc; + typedef Byte FAR *voidpf; + typedef Byte *voidp; +#endif + +#if !defined(Z_U4) && !defined(Z_SOLO) && defined(STDC) +# include +# if (UINT_MAX == 0xffffffffUL) +# define Z_U4 unsigned +# elif (ULONG_MAX == 0xffffffffUL) +# define Z_U4 unsigned long +# elif (USHRT_MAX == 0xffffffffUL) +# define Z_U4 unsigned short +# endif +#endif + +#ifdef Z_U4 + typedef Z_U4 z_crc_t; +#else + typedef unsigned long z_crc_t; +#endif + +#ifdef HAVE_UNISTD_H /* may be set to #if 1 by ./configure */ +# define Z_HAVE_UNISTD_H +#endif + +#ifdef HAVE_STDARG_H /* may be set to #if 1 by ./configure */ +# define Z_HAVE_STDARG_H +#endif + +#ifdef STDC +# ifndef Z_SOLO +# include /* for off_t */ +# endif +#endif + +#if defined(STDC) || defined(Z_HAVE_STDARG_H) +# ifndef Z_SOLO +# include /* for va_list */ +# endif +#endif + +#ifdef _WIN32 +# ifndef Z_SOLO +# include /* for wchar_t */ +# endif +#endif + +/* a little trick to accommodate both "#define _LARGEFILE64_SOURCE" and + * "#define _LARGEFILE64_SOURCE 1" as requesting 64-bit operations, (even + * though the former does not conform to the LFS document), but considering + * both "#undef _LARGEFILE64_SOURCE" and "#define _LARGEFILE64_SOURCE 0" as + * equivalently requesting no 64-bit operations + */ +#if defined(_LARGEFILE64_SOURCE) && -_LARGEFILE64_SOURCE - -1 == 1 +# undef _LARGEFILE64_SOURCE +#endif + +#if defined(__WATCOMC__) && !defined(Z_HAVE_UNISTD_H) +# define Z_HAVE_UNISTD_H +#endif +#ifndef Z_SOLO +# if defined(Z_HAVE_UNISTD_H) || defined(_LARGEFILE64_SOURCE) +# include /* for SEEK_*, off_t, and _LFS64_LARGEFILE */ +# ifdef VMS +# include /* for off_t */ +# endif +# ifndef z_off_t +# define z_off_t off_t +# endif +# endif +#endif + +#if defined(_LFS64_LARGEFILE) && _LFS64_LARGEFILE-0 +# define Z_LFS64 +#endif + +#if defined(_LARGEFILE64_SOURCE) && defined(Z_LFS64) +# define Z_LARGE64 +#endif + +#if defined(_FILE_OFFSET_BITS) && _FILE_OFFSET_BITS-0 == 64 && defined(Z_LFS64) +# define Z_WANT64 +#endif + +#if !defined(SEEK_SET) && !defined(Z_SOLO) +# define SEEK_SET 0 /* Seek from beginning of file. */ +# define SEEK_CUR 1 /* Seek from current position. */ +# define SEEK_END 2 /* Set file pointer to EOF plus "offset" */ +#endif + +#ifndef z_off_t +# define z_off_t long +#endif + +#if !defined(_WIN32) && defined(Z_LARGE64) +# define z_off64_t off64_t +#else +# if defined(_WIN32) && !defined(__GNUC__) && !defined(Z_SOLO) +# define z_off64_t __int64 +# else +# define z_off64_t z_off_t +# endif +#endif + +/* MVS linker does not support external names larger than 8 bytes */ +#if defined(__MVS__) + #pragma map(deflateInit_,"DEIN") + #pragma map(deflateInit2_,"DEIN2") + #pragma map(deflateEnd,"DEEND") + #pragma map(deflateBound,"DEBND") + #pragma map(inflateInit_,"ININ") + #pragma map(inflateInit2_,"ININ2") + #pragma map(inflateEnd,"INEND") + #pragma map(inflateSync,"INSY") + #pragma map(inflateSetDictionary,"INSEDI") + #pragma map(compressBound,"CMBND") + #pragma map(inflate_table,"INTABL") + #pragma map(inflate_fast,"INFA") + #pragma map(inflate_copyright,"INCOPY") +#endif + +#endif /* ZCONF_H */ diff --git a/PdbChecker/zlib/zlib.h b/PdbChecker/zlib/zlib.h new file mode 100644 index 0000000..f09cdaf --- /dev/null +++ b/PdbChecker/zlib/zlib.h @@ -0,0 +1,1912 @@ +/* zlib.h -- interface of the 'zlib' general purpose compression library + version 1.2.11, January 15th, 2017 + + Copyright (C) 1995-2017 Jean-loup Gailly and Mark Adler + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + Jean-loup Gailly Mark Adler + jloup@gzip.org madler@alumni.caltech.edu + + + The data format used by the zlib library is described by RFCs (Request for + Comments) 1950 to 1952 in the files http://tools.ietf.org/html/rfc1950 + (zlib format), rfc1951 (deflate format) and rfc1952 (gzip format). +*/ + +#ifndef ZLIB_H +#define ZLIB_H + +#include "zconf.h" + +#ifdef __cplusplus +extern "C" { +#endif + +#define ZLIB_VERSION "1.2.11" +#define ZLIB_VERNUM 0x12b0 +#define ZLIB_VER_MAJOR 1 +#define ZLIB_VER_MINOR 2 +#define ZLIB_VER_REVISION 11 +#define ZLIB_VER_SUBREVISION 0 + +/* + The 'zlib' compression library provides in-memory compression and + decompression functions, including integrity checks of the uncompressed data. + This version of the library supports only one compression method (deflation) + but other algorithms will be added later and will have the same stream + interface. + + Compression can be done in a single step if the buffers are large enough, + or can be done by repeated calls of the compression function. In the latter + case, the application must provide more input and/or consume the output + (providing more output space) before each call. + + The compressed data format used by default by the in-memory functions is + the zlib format, which is a zlib wrapper documented in RFC 1950, wrapped + around a deflate stream, which is itself documented in RFC 1951. + + The library also supports reading and writing files in gzip (.gz) format + with an interface similar to that of stdio using the functions that start + with "gz". The gzip format is different from the zlib format. gzip is a + gzip wrapper, documented in RFC 1952, wrapped around a deflate stream. + + This library can optionally read and write gzip and raw deflate streams in + memory as well. + + The zlib format was designed to be compact and fast for use in memory + and on communications channels. The gzip format was designed for single- + file compression on file systems, has a larger header than zlib to maintain + directory information, and uses a different, slower check method than zlib. + + The library does not install any signal handler. The decoder checks + the consistency of the compressed data, so the library should never crash + even in the case of corrupted input. +*/ + +typedef voidpf (*alloc_func) OF((voidpf opaque, uInt items, uInt size)); +typedef void (*free_func) OF((voidpf opaque, voidpf address)); + +struct internal_state; + +typedef struct z_stream_s { + z_const Bytef *next_in; /* next input byte */ + uInt avail_in; /* number of bytes available at next_in */ + uLong total_in; /* total number of input bytes read so far */ + + Bytef *next_out; /* next output byte will go here */ + uInt avail_out; /* remaining free space at next_out */ + uLong total_out; /* total number of bytes output so far */ + + z_const char *msg; /* last error message, NULL if no error */ + struct internal_state FAR *state; /* not visible by applications */ + + alloc_func zalloc; /* used to allocate the internal state */ + free_func zfree; /* used to free the internal state */ + voidpf opaque; /* private data object passed to zalloc and zfree */ + + int data_type; /* best guess about the data type: binary or text + for deflate, or the decoding state for inflate */ + uLong adler; /* Adler-32 or CRC-32 value of the uncompressed data */ + uLong reserved; /* reserved for future use */ +} z_stream; + +typedef z_stream FAR *z_streamp; + +/* + gzip header information passed to and from zlib routines. See RFC 1952 + for more details on the meanings of these fields. +*/ +typedef struct gz_header_s { + int text; /* true if compressed data believed to be text */ + uLong time; /* modification time */ + int xflags; /* extra flags (not used when writing a gzip file) */ + int os; /* operating system */ + Bytef *extra; /* pointer to extra field or Z_NULL if none */ + uInt extra_len; /* extra field length (valid if extra != Z_NULL) */ + uInt extra_max; /* space at extra (only when reading header) */ + Bytef *name; /* pointer to zero-terminated file name or Z_NULL */ + uInt name_max; /* space at name (only when reading header) */ + Bytef *comment; /* pointer to zero-terminated comment or Z_NULL */ + uInt comm_max; /* space at comment (only when reading header) */ + int hcrc; /* true if there was or will be a header crc */ + int done; /* true when done reading gzip header (not used + when writing a gzip file) */ +} gz_header; + +typedef gz_header FAR *gz_headerp; + +/* + The application must update next_in and avail_in when avail_in has dropped + to zero. It must update next_out and avail_out when avail_out has dropped + to zero. The application must initialize zalloc, zfree and opaque before + calling the init function. All other fields are set by the compression + library and must not be updated by the application. + + The opaque value provided by the application will be passed as the first + parameter for calls of zalloc and zfree. This can be useful for custom + memory management. The compression library attaches no meaning to the + opaque value. + + zalloc must return Z_NULL if there is not enough memory for the object. + If zlib is used in a multi-threaded application, zalloc and zfree must be + thread safe. In that case, zlib is thread-safe. When zalloc and zfree are + Z_NULL on entry to the initialization function, they are set to internal + routines that use the standard library functions malloc() and free(). + + On 16-bit systems, the functions zalloc and zfree must be able to allocate + exactly 65536 bytes, but will not be required to allocate more than this if + the symbol MAXSEG_64K is defined (see zconf.h). WARNING: On MSDOS, pointers + returned by zalloc for objects of exactly 65536 bytes *must* have their + offset normalized to zero. The default allocation function provided by this + library ensures this (see zutil.c). To reduce memory requirements and avoid + any allocation of 64K objects, at the expense of compression ratio, compile + the library with -DMAX_WBITS=14 (see zconf.h). + + The fields total_in and total_out can be used for statistics or progress + reports. After compression, total_in holds the total size of the + uncompressed data and may be saved for use by the decompressor (particularly + if the decompressor wants to decompress everything in a single step). +*/ + + /* constants */ + +#define Z_NO_FLUSH 0 +#define Z_PARTIAL_FLUSH 1 +#define Z_SYNC_FLUSH 2 +#define Z_FULL_FLUSH 3 +#define Z_FINISH 4 +#define Z_BLOCK 5 +#define Z_TREES 6 +/* Allowed flush values; see deflate() and inflate() below for details */ + +#define Z_OK 0 +#define Z_STREAM_END 1 +#define Z_NEED_DICT 2 +#define Z_ERRNO (-1) +#define Z_STREAM_ERROR (-2) +#define Z_DATA_ERROR (-3) +#define Z_MEM_ERROR (-4) +#define Z_BUF_ERROR (-5) +#define Z_VERSION_ERROR (-6) +/* Return codes for the compression/decompression functions. Negative values + * are errors, positive values are used for special but normal events. + */ + +#define Z_NO_COMPRESSION 0 +#define Z_BEST_SPEED 1 +#define Z_BEST_COMPRESSION 9 +#define Z_DEFAULT_COMPRESSION (-1) +/* compression levels */ + +#define Z_FILTERED 1 +#define Z_HUFFMAN_ONLY 2 +#define Z_RLE 3 +#define Z_FIXED 4 +#define Z_DEFAULT_STRATEGY 0 +/* compression strategy; see deflateInit2() below for details */ + +#define Z_BINARY 0 +#define Z_TEXT 1 +#define Z_ASCII Z_TEXT /* for compatibility with 1.2.2 and earlier */ +#define Z_UNKNOWN 2 +/* Possible values of the data_type field for deflate() */ + +#define Z_DEFLATED 8 +/* The deflate compression method (the only one supported in this version) */ + +#define Z_NULL 0 /* for initializing zalloc, zfree, opaque */ + +#define zlib_version zlibVersion() +/* for compatibility with versions < 1.0.2 */ + + + /* basic functions */ + +ZEXTERN const char * ZEXPORT zlibVersion OF((void)); +/* The application can compare zlibVersion and ZLIB_VERSION for consistency. + If the first character differs, the library code actually used is not + compatible with the zlib.h header file used by the application. This check + is automatically made by deflateInit and inflateInit. + */ + +/* +ZEXTERN int ZEXPORT deflateInit OF((z_streamp strm, int level)); + + Initializes the internal stream state for compression. The fields + zalloc, zfree and opaque must be initialized before by the caller. If + zalloc and zfree are set to Z_NULL, deflateInit updates them to use default + allocation functions. + + The compression level must be Z_DEFAULT_COMPRESSION, or between 0 and 9: + 1 gives best speed, 9 gives best compression, 0 gives no compression at all + (the input data is simply copied a block at a time). Z_DEFAULT_COMPRESSION + requests a default compromise between speed and compression (currently + equivalent to level 6). + + deflateInit returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_STREAM_ERROR if level is not a valid compression level, or + Z_VERSION_ERROR if the zlib library version (zlib_version) is incompatible + with the version assumed by the caller (ZLIB_VERSION). msg is set to null + if there is no error message. deflateInit does not perform any compression: + this will be done by deflate(). +*/ + + +ZEXTERN int ZEXPORT deflate OF((z_streamp strm, int flush)); +/* + deflate compresses as much data as possible, and stops when the input + buffer becomes empty or the output buffer becomes full. It may introduce + some output latency (reading input without producing any output) except when + forced to flush. + + The detailed semantics are as follows. deflate performs one or both of the + following actions: + + - Compress more input starting at next_in and update next_in and avail_in + accordingly. If not all input can be processed (because there is not + enough room in the output buffer), next_in and avail_in are updated and + processing will resume at this point for the next call of deflate(). + + - Generate more output starting at next_out and update next_out and avail_out + accordingly. This action is forced if the parameter flush is non zero. + Forcing flush frequently degrades the compression ratio, so this parameter + should be set only when necessary. Some output may be provided even if + flush is zero. + + Before the call of deflate(), the application should ensure that at least + one of the actions is possible, by providing more input and/or consuming more + output, and updating avail_in or avail_out accordingly; avail_out should + never be zero before the call. The application can consume the compressed + output when it wants, for example when the output buffer is full (avail_out + == 0), or after each call of deflate(). If deflate returns Z_OK and with + zero avail_out, it must be called again after making room in the output + buffer because there might be more output pending. See deflatePending(), + which can be used if desired to determine whether or not there is more ouput + in that case. + + Normally the parameter flush is set to Z_NO_FLUSH, which allows deflate to + decide how much data to accumulate before producing output, in order to + maximize compression. + + If the parameter flush is set to Z_SYNC_FLUSH, all pending output is + flushed to the output buffer and the output is aligned on a byte boundary, so + that the decompressor can get all input data available so far. (In + particular avail_in is zero after the call if enough output space has been + provided before the call.) Flushing may degrade compression for some + compression algorithms and so it should be used only when necessary. This + completes the current deflate block and follows it with an empty stored block + that is three bits plus filler bits to the next byte, followed by four bytes + (00 00 ff ff). + + If flush is set to Z_PARTIAL_FLUSH, all pending output is flushed to the + output buffer, but the output is not aligned to a byte boundary. All of the + input data so far will be available to the decompressor, as for Z_SYNC_FLUSH. + This completes the current deflate block and follows it with an empty fixed + codes block that is 10 bits long. This assures that enough bytes are output + in order for the decompressor to finish the block before the empty fixed + codes block. + + If flush is set to Z_BLOCK, a deflate block is completed and emitted, as + for Z_SYNC_FLUSH, but the output is not aligned on a byte boundary, and up to + seven bits of the current block are held to be written as the next byte after + the next deflate block is completed. In this case, the decompressor may not + be provided enough bits at this point in order to complete decompression of + the data provided so far to the compressor. It may need to wait for the next + block to be emitted. This is for advanced applications that need to control + the emission of deflate blocks. + + If flush is set to Z_FULL_FLUSH, all output is flushed as with + Z_SYNC_FLUSH, and the compression state is reset so that decompression can + restart from this point if previous compressed data has been damaged or if + random access is desired. Using Z_FULL_FLUSH too often can seriously degrade + compression. + + If deflate returns with avail_out == 0, this function must be called again + with the same value of the flush parameter and more output space (updated + avail_out), until the flush is complete (deflate returns with non-zero + avail_out). In the case of a Z_FULL_FLUSH or Z_SYNC_FLUSH, make sure that + avail_out is greater than six to avoid repeated flush markers due to + avail_out == 0 on return. + + If the parameter flush is set to Z_FINISH, pending input is processed, + pending output is flushed and deflate returns with Z_STREAM_END if there was + enough output space. If deflate returns with Z_OK or Z_BUF_ERROR, this + function must be called again with Z_FINISH and more output space (updated + avail_out) but no more input data, until it returns with Z_STREAM_END or an + error. After deflate has returned Z_STREAM_END, the only possible operations + on the stream are deflateReset or deflateEnd. + + Z_FINISH can be used in the first deflate call after deflateInit if all the + compression is to be done in a single step. In order to complete in one + call, avail_out must be at least the value returned by deflateBound (see + below). Then deflate is guaranteed to return Z_STREAM_END. If not enough + output space is provided, deflate will not return Z_STREAM_END, and it must + be called again as described above. + + deflate() sets strm->adler to the Adler-32 checksum of all input read + so far (that is, total_in bytes). If a gzip stream is being generated, then + strm->adler will be the CRC-32 checksum of the input read so far. (See + deflateInit2 below.) + + deflate() may update strm->data_type if it can make a good guess about + the input data type (Z_BINARY or Z_TEXT). If in doubt, the data is + considered binary. This field is only for information purposes and does not + affect the compression algorithm in any manner. + + deflate() returns Z_OK if some progress has been made (more input + processed or more output produced), Z_STREAM_END if all input has been + consumed and all output has been produced (only when flush is set to + Z_FINISH), Z_STREAM_ERROR if the stream state was inconsistent (for example + if next_in or next_out was Z_NULL or the state was inadvertently written over + by the application), or Z_BUF_ERROR if no progress is possible (for example + avail_in or avail_out was zero). Note that Z_BUF_ERROR is not fatal, and + deflate() can be called again with more input and more output space to + continue compressing. +*/ + + +ZEXTERN int ZEXPORT deflateEnd OF((z_streamp strm)); +/* + All dynamically allocated data structures for this stream are freed. + This function discards any unprocessed input and does not flush any pending + output. + + deflateEnd returns Z_OK if success, Z_STREAM_ERROR if the + stream state was inconsistent, Z_DATA_ERROR if the stream was freed + prematurely (some input or output was discarded). In the error case, msg + may be set but then points to a static string (which must not be + deallocated). +*/ + + +/* +ZEXTERN int ZEXPORT inflateInit OF((z_streamp strm)); + + Initializes the internal stream state for decompression. The fields + next_in, avail_in, zalloc, zfree and opaque must be initialized before by + the caller. In the current version of inflate, the provided input is not + read or consumed. The allocation of a sliding window will be deferred to + the first call of inflate (if the decompression does not complete on the + first call). If zalloc and zfree are set to Z_NULL, inflateInit updates + them to use default allocation functions. + + inflateInit returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_VERSION_ERROR if the zlib library version is incompatible with the + version assumed by the caller, or Z_STREAM_ERROR if the parameters are + invalid, such as a null pointer to the structure. msg is set to null if + there is no error message. inflateInit does not perform any decompression. + Actual decompression will be done by inflate(). So next_in, and avail_in, + next_out, and avail_out are unused and unchanged. The current + implementation of inflateInit() does not process any header information -- + that is deferred until inflate() is called. +*/ + + +ZEXTERN int ZEXPORT inflate OF((z_streamp strm, int flush)); +/* + inflate decompresses as much data as possible, and stops when the input + buffer becomes empty or the output buffer becomes full. It may introduce + some output latency (reading input without producing any output) except when + forced to flush. + + The detailed semantics are as follows. inflate performs one or both of the + following actions: + + - Decompress more input starting at next_in and update next_in and avail_in + accordingly. If not all input can be processed (because there is not + enough room in the output buffer), then next_in and avail_in are updated + accordingly, and processing will resume at this point for the next call of + inflate(). + + - Generate more output starting at next_out and update next_out and avail_out + accordingly. inflate() provides as much output as possible, until there is + no more input data or no more space in the output buffer (see below about + the flush parameter). + + Before the call of inflate(), the application should ensure that at least + one of the actions is possible, by providing more input and/or consuming more + output, and updating the next_* and avail_* values accordingly. If the + caller of inflate() does not provide both available input and available + output space, it is possible that there will be no progress made. The + application can consume the uncompressed output when it wants, for example + when the output buffer is full (avail_out == 0), or after each call of + inflate(). If inflate returns Z_OK and with zero avail_out, it must be + called again after making room in the output buffer because there might be + more output pending. + + The flush parameter of inflate() can be Z_NO_FLUSH, Z_SYNC_FLUSH, Z_FINISH, + Z_BLOCK, or Z_TREES. Z_SYNC_FLUSH requests that inflate() flush as much + output as possible to the output buffer. Z_BLOCK requests that inflate() + stop if and when it gets to the next deflate block boundary. When decoding + the zlib or gzip format, this will cause inflate() to return immediately + after the header and before the first block. When doing a raw inflate, + inflate() will go ahead and process the first block, and will return when it + gets to the end of that block, or when it runs out of data. + + The Z_BLOCK option assists in appending to or combining deflate streams. + To assist in this, on return inflate() always sets strm->data_type to the + number of unused bits in the last byte taken from strm->next_in, plus 64 if + inflate() is currently decoding the last block in the deflate stream, plus + 128 if inflate() returned immediately after decoding an end-of-block code or + decoding the complete header up to just before the first byte of the deflate + stream. The end-of-block will not be indicated until all of the uncompressed + data from that block has been written to strm->next_out. The number of + unused bits may in general be greater than seven, except when bit 7 of + data_type is set, in which case the number of unused bits will be less than + eight. data_type is set as noted here every time inflate() returns for all + flush options, and so can be used to determine the amount of currently + consumed input in bits. + + The Z_TREES option behaves as Z_BLOCK does, but it also returns when the + end of each deflate block header is reached, before any actual data in that + block is decoded. This allows the caller to determine the length of the + deflate block header for later use in random access within a deflate block. + 256 is added to the value of strm->data_type when inflate() returns + immediately after reaching the end of the deflate block header. + + inflate() should normally be called until it returns Z_STREAM_END or an + error. However if all decompression is to be performed in a single step (a + single call of inflate), the parameter flush should be set to Z_FINISH. In + this case all pending input is processed and all pending output is flushed; + avail_out must be large enough to hold all of the uncompressed data for the + operation to complete. (The size of the uncompressed data may have been + saved by the compressor for this purpose.) The use of Z_FINISH is not + required to perform an inflation in one step. However it may be used to + inform inflate that a faster approach can be used for the single inflate() + call. Z_FINISH also informs inflate to not maintain a sliding window if the + stream completes, which reduces inflate's memory footprint. If the stream + does not complete, either because not all of the stream is provided or not + enough output space is provided, then a sliding window will be allocated and + inflate() can be called again to continue the operation as if Z_NO_FLUSH had + been used. + + In this implementation, inflate() always flushes as much output as + possible to the output buffer, and always uses the faster approach on the + first call. So the effects of the flush parameter in this implementation are + on the return value of inflate() as noted below, when inflate() returns early + when Z_BLOCK or Z_TREES is used, and when inflate() avoids the allocation of + memory for a sliding window when Z_FINISH is used. + + If a preset dictionary is needed after this call (see inflateSetDictionary + below), inflate sets strm->adler to the Adler-32 checksum of the dictionary + chosen by the compressor and returns Z_NEED_DICT; otherwise it sets + strm->adler to the Adler-32 checksum of all output produced so far (that is, + total_out bytes) and returns Z_OK, Z_STREAM_END or an error code as described + below. At the end of the stream, inflate() checks that its computed Adler-32 + checksum is equal to that saved by the compressor and returns Z_STREAM_END + only if the checksum is correct. + + inflate() can decompress and check either zlib-wrapped or gzip-wrapped + deflate data. The header type is detected automatically, if requested when + initializing with inflateInit2(). Any information contained in the gzip + header is not retained unless inflateGetHeader() is used. When processing + gzip-wrapped deflate data, strm->adler32 is set to the CRC-32 of the output + produced so far. The CRC-32 is checked against the gzip trailer, as is the + uncompressed length, modulo 2^32. + + inflate() returns Z_OK if some progress has been made (more input processed + or more output produced), Z_STREAM_END if the end of the compressed data has + been reached and all uncompressed output has been produced, Z_NEED_DICT if a + preset dictionary is needed at this point, Z_DATA_ERROR if the input data was + corrupted (input stream not conforming to the zlib format or incorrect check + value, in which case strm->msg points to a string with a more specific + error), Z_STREAM_ERROR if the stream structure was inconsistent (for example + next_in or next_out was Z_NULL, or the state was inadvertently written over + by the application), Z_MEM_ERROR if there was not enough memory, Z_BUF_ERROR + if no progress was possible or if there was not enough room in the output + buffer when Z_FINISH is used. Note that Z_BUF_ERROR is not fatal, and + inflate() can be called again with more input and more output space to + continue decompressing. If Z_DATA_ERROR is returned, the application may + then call inflateSync() to look for a good compression block if a partial + recovery of the data is to be attempted. +*/ + + +ZEXTERN int ZEXPORT inflateEnd OF((z_streamp strm)); +/* + All dynamically allocated data structures for this stream are freed. + This function discards any unprocessed input and does not flush any pending + output. + + inflateEnd returns Z_OK if success, or Z_STREAM_ERROR if the stream state + was inconsistent. +*/ + + + /* Advanced functions */ + +/* + The following functions are needed only in some special applications. +*/ + +/* +ZEXTERN int ZEXPORT deflateInit2 OF((z_streamp strm, + int level, + int method, + int windowBits, + int memLevel, + int strategy)); + + This is another version of deflateInit with more compression options. The + fields next_in, zalloc, zfree and opaque must be initialized before by the + caller. + + The method parameter is the compression method. It must be Z_DEFLATED in + this version of the library. + + The windowBits parameter is the base two logarithm of the window size + (the size of the history buffer). It should be in the range 8..15 for this + version of the library. Larger values of this parameter result in better + compression at the expense of memory usage. The default value is 15 if + deflateInit is used instead. + + For the current implementation of deflate(), a windowBits value of 8 (a + window size of 256 bytes) is not supported. As a result, a request for 8 + will result in 9 (a 512-byte window). In that case, providing 8 to + inflateInit2() will result in an error when the zlib header with 9 is + checked against the initialization of inflate(). The remedy is to not use 8 + with deflateInit2() with this initialization, or at least in that case use 9 + with inflateInit2(). + + windowBits can also be -8..-15 for raw deflate. In this case, -windowBits + determines the window size. deflate() will then generate raw deflate data + with no zlib header or trailer, and will not compute a check value. + + windowBits can also be greater than 15 for optional gzip encoding. Add + 16 to windowBits to write a simple gzip header and trailer around the + compressed data instead of a zlib wrapper. The gzip header will have no + file name, no extra data, no comment, no modification time (set to zero), no + header crc, and the operating system will be set to the appropriate value, + if the operating system was determined at compile time. If a gzip stream is + being written, strm->adler is a CRC-32 instead of an Adler-32. + + For raw deflate or gzip encoding, a request for a 256-byte window is + rejected as invalid, since only the zlib header provides a means of + transmitting the window size to the decompressor. + + The memLevel parameter specifies how much memory should be allocated + for the internal compression state. memLevel=1 uses minimum memory but is + slow and reduces compression ratio; memLevel=9 uses maximum memory for + optimal speed. The default value is 8. See zconf.h for total memory usage + as a function of windowBits and memLevel. + + The strategy parameter is used to tune the compression algorithm. Use the + value Z_DEFAULT_STRATEGY for normal data, Z_FILTERED for data produced by a + filter (or predictor), Z_HUFFMAN_ONLY to force Huffman encoding only (no + string match), or Z_RLE to limit match distances to one (run-length + encoding). Filtered data consists mostly of small values with a somewhat + random distribution. In this case, the compression algorithm is tuned to + compress them better. The effect of Z_FILTERED is to force more Huffman + coding and less string matching; it is somewhat intermediate between + Z_DEFAULT_STRATEGY and Z_HUFFMAN_ONLY. Z_RLE is designed to be almost as + fast as Z_HUFFMAN_ONLY, but give better compression for PNG image data. The + strategy parameter only affects the compression ratio but not the + correctness of the compressed output even if it is not set appropriately. + Z_FIXED prevents the use of dynamic Huffman codes, allowing for a simpler + decoder for special applications. + + deflateInit2 returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_STREAM_ERROR if any parameter is invalid (such as an invalid + method), or Z_VERSION_ERROR if the zlib library version (zlib_version) is + incompatible with the version assumed by the caller (ZLIB_VERSION). msg is + set to null if there is no error message. deflateInit2 does not perform any + compression: this will be done by deflate(). +*/ + +ZEXTERN int ZEXPORT deflateSetDictionary OF((z_streamp strm, + const Bytef *dictionary, + uInt dictLength)); +/* + Initializes the compression dictionary from the given byte sequence + without producing any compressed output. When using the zlib format, this + function must be called immediately after deflateInit, deflateInit2 or + deflateReset, and before any call of deflate. When doing raw deflate, this + function must be called either before any call of deflate, or immediately + after the completion of a deflate block, i.e. after all input has been + consumed and all output has been delivered when using any of the flush + options Z_BLOCK, Z_PARTIAL_FLUSH, Z_SYNC_FLUSH, or Z_FULL_FLUSH. The + compressor and decompressor must use exactly the same dictionary (see + inflateSetDictionary). + + The dictionary should consist of strings (byte sequences) that are likely + to be encountered later in the data to be compressed, with the most commonly + used strings preferably put towards the end of the dictionary. Using a + dictionary is most useful when the data to be compressed is short and can be + predicted with good accuracy; the data can then be compressed better than + with the default empty dictionary. + + Depending on the size of the compression data structures selected by + deflateInit or deflateInit2, a part of the dictionary may in effect be + discarded, for example if the dictionary is larger than the window size + provided in deflateInit or deflateInit2. Thus the strings most likely to be + useful should be put at the end of the dictionary, not at the front. In + addition, the current implementation of deflate will use at most the window + size minus 262 bytes of the provided dictionary. + + Upon return of this function, strm->adler is set to the Adler-32 value + of the dictionary; the decompressor may later use this value to determine + which dictionary has been used by the compressor. (The Adler-32 value + applies to the whole dictionary even if only a subset of the dictionary is + actually used by the compressor.) If a raw deflate was requested, then the + Adler-32 value is not computed and strm->adler is not set. + + deflateSetDictionary returns Z_OK if success, or Z_STREAM_ERROR if a + parameter is invalid (e.g. dictionary being Z_NULL) or the stream state is + inconsistent (for example if deflate has already been called for this stream + or if not at a block boundary for raw deflate). deflateSetDictionary does + not perform any compression: this will be done by deflate(). +*/ + +ZEXTERN int ZEXPORT deflateGetDictionary OF((z_streamp strm, + Bytef *dictionary, + uInt *dictLength)); +/* + Returns the sliding dictionary being maintained by deflate. dictLength is + set to the number of bytes in the dictionary, and that many bytes are copied + to dictionary. dictionary must have enough space, where 32768 bytes is + always enough. If deflateGetDictionary() is called with dictionary equal to + Z_NULL, then only the dictionary length is returned, and nothing is copied. + Similary, if dictLength is Z_NULL, then it is not set. + + deflateGetDictionary() may return a length less than the window size, even + when more than the window size in input has been provided. It may return up + to 258 bytes less in that case, due to how zlib's implementation of deflate + manages the sliding window and lookahead for matches, where matches can be + up to 258 bytes long. If the application needs the last window-size bytes of + input, then that would need to be saved by the application outside of zlib. + + deflateGetDictionary returns Z_OK on success, or Z_STREAM_ERROR if the + stream state is inconsistent. +*/ + +ZEXTERN int ZEXPORT deflateCopy OF((z_streamp dest, + z_streamp source)); +/* + Sets the destination stream as a complete copy of the source stream. + + This function can be useful when several compression strategies will be + tried, for example when there are several ways of pre-processing the input + data with a filter. The streams that will be discarded should then be freed + by calling deflateEnd. Note that deflateCopy duplicates the internal + compression state which can be quite large, so this strategy is slow and can + consume lots of memory. + + deflateCopy returns Z_OK if success, Z_MEM_ERROR if there was not + enough memory, Z_STREAM_ERROR if the source stream state was inconsistent + (such as zalloc being Z_NULL). msg is left unchanged in both source and + destination. +*/ + +ZEXTERN int ZEXPORT deflateReset OF((z_streamp strm)); +/* + This function is equivalent to deflateEnd followed by deflateInit, but + does not free and reallocate the internal compression state. The stream + will leave the compression level and any other attributes that may have been + set unchanged. + + deflateReset returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent (such as zalloc or state being Z_NULL). +*/ + +ZEXTERN int ZEXPORT deflateParams OF((z_streamp strm, + int level, + int strategy)); +/* + Dynamically update the compression level and compression strategy. The + interpretation of level and strategy is as in deflateInit2(). This can be + used to switch between compression and straight copy of the input data, or + to switch to a different kind of input data requiring a different strategy. + If the compression approach (which is a function of the level) or the + strategy is changed, and if any input has been consumed in a previous + deflate() call, then the input available so far is compressed with the old + level and strategy using deflate(strm, Z_BLOCK). There are three approaches + for the compression levels 0, 1..3, and 4..9 respectively. The new level + and strategy will take effect at the next call of deflate(). + + If a deflate(strm, Z_BLOCK) is performed by deflateParams(), and it does + not have enough output space to complete, then the parameter change will not + take effect. In this case, deflateParams() can be called again with the + same parameters and more output space to try again. + + In order to assure a change in the parameters on the first try, the + deflate stream should be flushed using deflate() with Z_BLOCK or other flush + request until strm.avail_out is not zero, before calling deflateParams(). + Then no more input data should be provided before the deflateParams() call. + If this is done, the old level and strategy will be applied to the data + compressed before deflateParams(), and the new level and strategy will be + applied to the the data compressed after deflateParams(). + + deflateParams returns Z_OK on success, Z_STREAM_ERROR if the source stream + state was inconsistent or if a parameter was invalid, or Z_BUF_ERROR if + there was not enough output space to complete the compression of the + available input data before a change in the strategy or approach. Note that + in the case of a Z_BUF_ERROR, the parameters are not changed. A return + value of Z_BUF_ERROR is not fatal, in which case deflateParams() can be + retried with more output space. +*/ + +ZEXTERN int ZEXPORT deflateTune OF((z_streamp strm, + int good_length, + int max_lazy, + int nice_length, + int max_chain)); +/* + Fine tune deflate's internal compression parameters. This should only be + used by someone who understands the algorithm used by zlib's deflate for + searching for the best matching string, and even then only by the most + fanatic optimizer trying to squeeze out the last compressed bit for their + specific input data. Read the deflate.c source code for the meaning of the + max_lazy, good_length, nice_length, and max_chain parameters. + + deflateTune() can be called after deflateInit() or deflateInit2(), and + returns Z_OK on success, or Z_STREAM_ERROR for an invalid deflate stream. + */ + +ZEXTERN uLong ZEXPORT deflateBound OF((z_streamp strm, + uLong sourceLen)); +/* + deflateBound() returns an upper bound on the compressed size after + deflation of sourceLen bytes. It must be called after deflateInit() or + deflateInit2(), and after deflateSetHeader(), if used. This would be used + to allocate an output buffer for deflation in a single pass, and so would be + called before deflate(). If that first deflate() call is provided the + sourceLen input bytes, an output buffer allocated to the size returned by + deflateBound(), and the flush value Z_FINISH, then deflate() is guaranteed + to return Z_STREAM_END. Note that it is possible for the compressed size to + be larger than the value returned by deflateBound() if flush options other + than Z_FINISH or Z_NO_FLUSH are used. +*/ + +ZEXTERN int ZEXPORT deflatePending OF((z_streamp strm, + unsigned *pending, + int *bits)); +/* + deflatePending() returns the number of bytes and bits of output that have + been generated, but not yet provided in the available output. The bytes not + provided would be due to the available output space having being consumed. + The number of bits of output not provided are between 0 and 7, where they + await more bits to join them in order to fill out a full byte. If pending + or bits are Z_NULL, then those values are not set. + + deflatePending returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent. + */ + +ZEXTERN int ZEXPORT deflatePrime OF((z_streamp strm, + int bits, + int value)); +/* + deflatePrime() inserts bits in the deflate output stream. The intent + is that this function is used to start off the deflate output with the bits + leftover from a previous deflate stream when appending to it. As such, this + function can only be used for raw deflate, and must be used before the first + deflate() call after a deflateInit2() or deflateReset(). bits must be less + than or equal to 16, and that many of the least significant bits of value + will be inserted in the output. + + deflatePrime returns Z_OK if success, Z_BUF_ERROR if there was not enough + room in the internal buffer to insert the bits, or Z_STREAM_ERROR if the + source stream state was inconsistent. +*/ + +ZEXTERN int ZEXPORT deflateSetHeader OF((z_streamp strm, + gz_headerp head)); +/* + deflateSetHeader() provides gzip header information for when a gzip + stream is requested by deflateInit2(). deflateSetHeader() may be called + after deflateInit2() or deflateReset() and before the first call of + deflate(). The text, time, os, extra field, name, and comment information + in the provided gz_header structure are written to the gzip header (xflag is + ignored -- the extra flags are set according to the compression level). The + caller must assure that, if not Z_NULL, name and comment are terminated with + a zero byte, and that if extra is not Z_NULL, that extra_len bytes are + available there. If hcrc is true, a gzip header crc is included. Note that + the current versions of the command-line version of gzip (up through version + 1.3.x) do not support header crc's, and will report that it is a "multi-part + gzip file" and give up. + + If deflateSetHeader is not used, the default gzip header has text false, + the time set to zero, and os set to 255, with no extra, name, or comment + fields. The gzip header is returned to the default state by deflateReset(). + + deflateSetHeader returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent. +*/ + +/* +ZEXTERN int ZEXPORT inflateInit2 OF((z_streamp strm, + int windowBits)); + + This is another version of inflateInit with an extra parameter. The + fields next_in, avail_in, zalloc, zfree and opaque must be initialized + before by the caller. + + The windowBits parameter is the base two logarithm of the maximum window + size (the size of the history buffer). It should be in the range 8..15 for + this version of the library. The default value is 15 if inflateInit is used + instead. windowBits must be greater than or equal to the windowBits value + provided to deflateInit2() while compressing, or it must be equal to 15 if + deflateInit2() was not used. If a compressed stream with a larger window + size is given as input, inflate() will return with the error code + Z_DATA_ERROR instead of trying to allocate a larger window. + + windowBits can also be zero to request that inflate use the window size in + the zlib header of the compressed stream. + + windowBits can also be -8..-15 for raw inflate. In this case, -windowBits + determines the window size. inflate() will then process raw deflate data, + not looking for a zlib or gzip header, not generating a check value, and not + looking for any check values for comparison at the end of the stream. This + is for use with other formats that use the deflate compressed data format + such as zip. Those formats provide their own check values. If a custom + format is developed using the raw deflate format for compressed data, it is + recommended that a check value such as an Adler-32 or a CRC-32 be applied to + the uncompressed data as is done in the zlib, gzip, and zip formats. For + most applications, the zlib format should be used as is. Note that comments + above on the use in deflateInit2() applies to the magnitude of windowBits. + + windowBits can also be greater than 15 for optional gzip decoding. Add + 32 to windowBits to enable zlib and gzip decoding with automatic header + detection, or add 16 to decode only the gzip format (the zlib format will + return a Z_DATA_ERROR). If a gzip stream is being decoded, strm->adler is a + CRC-32 instead of an Adler-32. Unlike the gunzip utility and gzread() (see + below), inflate() will not automatically decode concatenated gzip streams. + inflate() will return Z_STREAM_END at the end of the gzip stream. The state + would need to be reset to continue decoding a subsequent gzip stream. + + inflateInit2 returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_VERSION_ERROR if the zlib library version is incompatible with the + version assumed by the caller, or Z_STREAM_ERROR if the parameters are + invalid, such as a null pointer to the structure. msg is set to null if + there is no error message. inflateInit2 does not perform any decompression + apart from possibly reading the zlib header if present: actual decompression + will be done by inflate(). (So next_in and avail_in may be modified, but + next_out and avail_out are unused and unchanged.) The current implementation + of inflateInit2() does not process any header information -- that is + deferred until inflate() is called. +*/ + +ZEXTERN int ZEXPORT inflateSetDictionary OF((z_streamp strm, + const Bytef *dictionary, + uInt dictLength)); +/* + Initializes the decompression dictionary from the given uncompressed byte + sequence. This function must be called immediately after a call of inflate, + if that call returned Z_NEED_DICT. The dictionary chosen by the compressor + can be determined from the Adler-32 value returned by that call of inflate. + The compressor and decompressor must use exactly the same dictionary (see + deflateSetDictionary). For raw inflate, this function can be called at any + time to set the dictionary. If the provided dictionary is smaller than the + window and there is already data in the window, then the provided dictionary + will amend what's there. The application must insure that the dictionary + that was used for compression is provided. + + inflateSetDictionary returns Z_OK if success, Z_STREAM_ERROR if a + parameter is invalid (e.g. dictionary being Z_NULL) or the stream state is + inconsistent, Z_DATA_ERROR if the given dictionary doesn't match the + expected one (incorrect Adler-32 value). inflateSetDictionary does not + perform any decompression: this will be done by subsequent calls of + inflate(). +*/ + +ZEXTERN int ZEXPORT inflateGetDictionary OF((z_streamp strm, + Bytef *dictionary, + uInt *dictLength)); +/* + Returns the sliding dictionary being maintained by inflate. dictLength is + set to the number of bytes in the dictionary, and that many bytes are copied + to dictionary. dictionary must have enough space, where 32768 bytes is + always enough. If inflateGetDictionary() is called with dictionary equal to + Z_NULL, then only the dictionary length is returned, and nothing is copied. + Similary, if dictLength is Z_NULL, then it is not set. + + inflateGetDictionary returns Z_OK on success, or Z_STREAM_ERROR if the + stream state is inconsistent. +*/ + +ZEXTERN int ZEXPORT inflateSync OF((z_streamp strm)); +/* + Skips invalid compressed data until a possible full flush point (see above + for the description of deflate with Z_FULL_FLUSH) can be found, or until all + available input is skipped. No output is provided. + + inflateSync searches for a 00 00 FF FF pattern in the compressed data. + All full flush points have this pattern, but not all occurrences of this + pattern are full flush points. + + inflateSync returns Z_OK if a possible full flush point has been found, + Z_BUF_ERROR if no more input was provided, Z_DATA_ERROR if no flush point + has been found, or Z_STREAM_ERROR if the stream structure was inconsistent. + In the success case, the application may save the current current value of + total_in which indicates where valid compressed data was found. In the + error case, the application may repeatedly call inflateSync, providing more + input each time, until success or end of the input data. +*/ + +ZEXTERN int ZEXPORT inflateCopy OF((z_streamp dest, + z_streamp source)); +/* + Sets the destination stream as a complete copy of the source stream. + + This function can be useful when randomly accessing a large stream. The + first pass through the stream can periodically record the inflate state, + allowing restarting inflate at those points when randomly accessing the + stream. + + inflateCopy returns Z_OK if success, Z_MEM_ERROR if there was not + enough memory, Z_STREAM_ERROR if the source stream state was inconsistent + (such as zalloc being Z_NULL). msg is left unchanged in both source and + destination. +*/ + +ZEXTERN int ZEXPORT inflateReset OF((z_streamp strm)); +/* + This function is equivalent to inflateEnd followed by inflateInit, + but does not free and reallocate the internal decompression state. The + stream will keep attributes that may have been set by inflateInit2. + + inflateReset returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent (such as zalloc or state being Z_NULL). +*/ + +ZEXTERN int ZEXPORT inflateReset2 OF((z_streamp strm, + int windowBits)); +/* + This function is the same as inflateReset, but it also permits changing + the wrap and window size requests. The windowBits parameter is interpreted + the same as it is for inflateInit2. If the window size is changed, then the + memory allocated for the window is freed, and the window will be reallocated + by inflate() if needed. + + inflateReset2 returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent (such as zalloc or state being Z_NULL), or if + the windowBits parameter is invalid. +*/ + +ZEXTERN int ZEXPORT inflatePrime OF((z_streamp strm, + int bits, + int value)); +/* + This function inserts bits in the inflate input stream. The intent is + that this function is used to start inflating at a bit position in the + middle of a byte. The provided bits will be used before any bytes are used + from next_in. This function should only be used with raw inflate, and + should be used before the first inflate() call after inflateInit2() or + inflateReset(). bits must be less than or equal to 16, and that many of the + least significant bits of value will be inserted in the input. + + If bits is negative, then the input stream bit buffer is emptied. Then + inflatePrime() can be called again to put bits in the buffer. This is used + to clear out bits leftover after feeding inflate a block description prior + to feeding inflate codes. + + inflatePrime returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent. +*/ + +ZEXTERN long ZEXPORT inflateMark OF((z_streamp strm)); +/* + This function returns two values, one in the lower 16 bits of the return + value, and the other in the remaining upper bits, obtained by shifting the + return value down 16 bits. If the upper value is -1 and the lower value is + zero, then inflate() is currently decoding information outside of a block. + If the upper value is -1 and the lower value is non-zero, then inflate is in + the middle of a stored block, with the lower value equaling the number of + bytes from the input remaining to copy. If the upper value is not -1, then + it is the number of bits back from the current bit position in the input of + the code (literal or length/distance pair) currently being processed. In + that case the lower value is the number of bytes already emitted for that + code. + + A code is being processed if inflate is waiting for more input to complete + decoding of the code, or if it has completed decoding but is waiting for + more output space to write the literal or match data. + + inflateMark() is used to mark locations in the input data for random + access, which may be at bit positions, and to note those cases where the + output of a code may span boundaries of random access blocks. The current + location in the input stream can be determined from avail_in and data_type + as noted in the description for the Z_BLOCK flush parameter for inflate. + + inflateMark returns the value noted above, or -65536 if the provided + source stream state was inconsistent. +*/ + +ZEXTERN int ZEXPORT inflateGetHeader OF((z_streamp strm, + gz_headerp head)); +/* + inflateGetHeader() requests that gzip header information be stored in the + provided gz_header structure. inflateGetHeader() may be called after + inflateInit2() or inflateReset(), and before the first call of inflate(). + As inflate() processes the gzip stream, head->done is zero until the header + is completed, at which time head->done is set to one. If a zlib stream is + being decoded, then head->done is set to -1 to indicate that there will be + no gzip header information forthcoming. Note that Z_BLOCK or Z_TREES can be + used to force inflate() to return immediately after header processing is + complete and before any actual data is decompressed. + + The text, time, xflags, and os fields are filled in with the gzip header + contents. hcrc is set to true if there is a header CRC. (The header CRC + was valid if done is set to one.) If extra is not Z_NULL, then extra_max + contains the maximum number of bytes to write to extra. Once done is true, + extra_len contains the actual extra field length, and extra contains the + extra field, or that field truncated if extra_max is less than extra_len. + If name is not Z_NULL, then up to name_max characters are written there, + terminated with a zero unless the length is greater than name_max. If + comment is not Z_NULL, then up to comm_max characters are written there, + terminated with a zero unless the length is greater than comm_max. When any + of extra, name, or comment are not Z_NULL and the respective field is not + present in the header, then that field is set to Z_NULL to signal its + absence. This allows the use of deflateSetHeader() with the returned + structure to duplicate the header. However if those fields are set to + allocated memory, then the application will need to save those pointers + elsewhere so that they can be eventually freed. + + If inflateGetHeader is not used, then the header information is simply + discarded. The header is always checked for validity, including the header + CRC if present. inflateReset() will reset the process to discard the header + information. The application would need to call inflateGetHeader() again to + retrieve the header from the next gzip stream. + + inflateGetHeader returns Z_OK if success, or Z_STREAM_ERROR if the source + stream state was inconsistent. +*/ + +/* +ZEXTERN int ZEXPORT inflateBackInit OF((z_streamp strm, int windowBits, + unsigned char FAR *window)); + + Initialize the internal stream state for decompression using inflateBack() + calls. The fields zalloc, zfree and opaque in strm must be initialized + before the call. If zalloc and zfree are Z_NULL, then the default library- + derived memory allocation routines are used. windowBits is the base two + logarithm of the window size, in the range 8..15. window is a caller + supplied buffer of that size. Except for special applications where it is + assured that deflate was used with small window sizes, windowBits must be 15 + and a 32K byte window must be supplied to be able to decompress general + deflate streams. + + See inflateBack() for the usage of these routines. + + inflateBackInit will return Z_OK on success, Z_STREAM_ERROR if any of + the parameters are invalid, Z_MEM_ERROR if the internal state could not be + allocated, or Z_VERSION_ERROR if the version of the library does not match + the version of the header file. +*/ + +typedef unsigned (*in_func) OF((void FAR *, + z_const unsigned char FAR * FAR *)); +typedef int (*out_func) OF((void FAR *, unsigned char FAR *, unsigned)); + +ZEXTERN int ZEXPORT inflateBack OF((z_streamp strm, + in_func in, void FAR *in_desc, + out_func out, void FAR *out_desc)); +/* + inflateBack() does a raw inflate with a single call using a call-back + interface for input and output. This is potentially more efficient than + inflate() for file i/o applications, in that it avoids copying between the + output and the sliding window by simply making the window itself the output + buffer. inflate() can be faster on modern CPUs when used with large + buffers. inflateBack() trusts the application to not change the output + buffer passed by the output function, at least until inflateBack() returns. + + inflateBackInit() must be called first to allocate the internal state + and to initialize the state with the user-provided window buffer. + inflateBack() may then be used multiple times to inflate a complete, raw + deflate stream with each call. inflateBackEnd() is then called to free the + allocated state. + + A raw deflate stream is one with no zlib or gzip header or trailer. + This routine would normally be used in a utility that reads zip or gzip + files and writes out uncompressed files. The utility would decode the + header and process the trailer on its own, hence this routine expects only + the raw deflate stream to decompress. This is different from the default + behavior of inflate(), which expects a zlib header and trailer around the + deflate stream. + + inflateBack() uses two subroutines supplied by the caller that are then + called by inflateBack() for input and output. inflateBack() calls those + routines until it reads a complete deflate stream and writes out all of the + uncompressed data, or until it encounters an error. The function's + parameters and return types are defined above in the in_func and out_func + typedefs. inflateBack() will call in(in_desc, &buf) which should return the + number of bytes of provided input, and a pointer to that input in buf. If + there is no input available, in() must return zero -- buf is ignored in that + case -- and inflateBack() will return a buffer error. inflateBack() will + call out(out_desc, buf, len) to write the uncompressed data buf[0..len-1]. + out() should return zero on success, or non-zero on failure. If out() + returns non-zero, inflateBack() will return with an error. Neither in() nor + out() are permitted to change the contents of the window provided to + inflateBackInit(), which is also the buffer that out() uses to write from. + The length written by out() will be at most the window size. Any non-zero + amount of input may be provided by in(). + + For convenience, inflateBack() can be provided input on the first call by + setting strm->next_in and strm->avail_in. If that input is exhausted, then + in() will be called. Therefore strm->next_in must be initialized before + calling inflateBack(). If strm->next_in is Z_NULL, then in() will be called + immediately for input. If strm->next_in is not Z_NULL, then strm->avail_in + must also be initialized, and then if strm->avail_in is not zero, input will + initially be taken from strm->next_in[0 .. strm->avail_in - 1]. + + The in_desc and out_desc parameters of inflateBack() is passed as the + first parameter of in() and out() respectively when they are called. These + descriptors can be optionally used to pass any information that the caller- + supplied in() and out() functions need to do their job. + + On return, inflateBack() will set strm->next_in and strm->avail_in to + pass back any unused input that was provided by the last in() call. The + return values of inflateBack() can be Z_STREAM_END on success, Z_BUF_ERROR + if in() or out() returned an error, Z_DATA_ERROR if there was a format error + in the deflate stream (in which case strm->msg is set to indicate the nature + of the error), or Z_STREAM_ERROR if the stream was not properly initialized. + In the case of Z_BUF_ERROR, an input or output error can be distinguished + using strm->next_in which will be Z_NULL only if in() returned an error. If + strm->next_in is not Z_NULL, then the Z_BUF_ERROR was due to out() returning + non-zero. (in() will always be called before out(), so strm->next_in is + assured to be defined if out() returns non-zero.) Note that inflateBack() + cannot return Z_OK. +*/ + +ZEXTERN int ZEXPORT inflateBackEnd OF((z_streamp strm)); +/* + All memory allocated by inflateBackInit() is freed. + + inflateBackEnd() returns Z_OK on success, or Z_STREAM_ERROR if the stream + state was inconsistent. +*/ + +ZEXTERN uLong ZEXPORT zlibCompileFlags OF((void)); +/* Return flags indicating compile-time options. + + Type sizes, two bits each, 00 = 16 bits, 01 = 32, 10 = 64, 11 = other: + 1.0: size of uInt + 3.2: size of uLong + 5.4: size of voidpf (pointer) + 7.6: size of z_off_t + + Compiler, assembler, and debug options: + 8: ZLIB_DEBUG + 9: ASMV or ASMINF -- use ASM code + 10: ZLIB_WINAPI -- exported functions use the WINAPI calling convention + 11: 0 (reserved) + + One-time table building (smaller code, but not thread-safe if true): + 12: BUILDFIXED -- build static block decoding tables when needed + 13: DYNAMIC_CRC_TABLE -- build CRC calculation tables when needed + 14,15: 0 (reserved) + + Library content (indicates missing functionality): + 16: NO_GZCOMPRESS -- gz* functions cannot compress (to avoid linking + deflate code when not needed) + 17: NO_GZIP -- deflate can't write gzip streams, and inflate can't detect + and decode gzip streams (to avoid linking crc code) + 18-19: 0 (reserved) + + Operation variations (changes in library functionality): + 20: PKZIP_BUG_WORKAROUND -- slightly more permissive inflate + 21: FASTEST -- deflate algorithm with only one, lowest compression level + 22,23: 0 (reserved) + + The sprintf variant used by gzprintf (zero is best): + 24: 0 = vs*, 1 = s* -- 1 means limited to 20 arguments after the format + 25: 0 = *nprintf, 1 = *printf -- 1 means gzprintf() not secure! + 26: 0 = returns value, 1 = void -- 1 means inferred string length returned + + Remainder: + 27-31: 0 (reserved) + */ + +#ifndef Z_SOLO + + /* utility functions */ + +/* + The following utility functions are implemented on top of the basic + stream-oriented functions. To simplify the interface, some default options + are assumed (compression level and memory usage, standard memory allocation + functions). The source code of these utility functions can be modified if + you need special options. +*/ + +ZEXTERN int ZEXPORT compress OF((Bytef *dest, uLongf *destLen, + const Bytef *source, uLong sourceLen)); +/* + Compresses the source buffer into the destination buffer. sourceLen is + the byte length of the source buffer. Upon entry, destLen is the total size + of the destination buffer, which must be at least the value returned by + compressBound(sourceLen). Upon exit, destLen is the actual size of the + compressed data. compress() is equivalent to compress2() with a level + parameter of Z_DEFAULT_COMPRESSION. + + compress returns Z_OK if success, Z_MEM_ERROR if there was not + enough memory, Z_BUF_ERROR if there was not enough room in the output + buffer. +*/ + +ZEXTERN int ZEXPORT compress2 OF((Bytef *dest, uLongf *destLen, + const Bytef *source, uLong sourceLen, + int level)); +/* + Compresses the source buffer into the destination buffer. The level + parameter has the same meaning as in deflateInit. sourceLen is the byte + length of the source buffer. Upon entry, destLen is the total size of the + destination buffer, which must be at least the value returned by + compressBound(sourceLen). Upon exit, destLen is the actual size of the + compressed data. + + compress2 returns Z_OK if success, Z_MEM_ERROR if there was not enough + memory, Z_BUF_ERROR if there was not enough room in the output buffer, + Z_STREAM_ERROR if the level parameter is invalid. +*/ + +ZEXTERN uLong ZEXPORT compressBound OF((uLong sourceLen)); +/* + compressBound() returns an upper bound on the compressed size after + compress() or compress2() on sourceLen bytes. It would be used before a + compress() or compress2() call to allocate the destination buffer. +*/ + +ZEXTERN int ZEXPORT uncompress OF((Bytef *dest, uLongf *destLen, + const Bytef *source, uLong sourceLen)); +/* + Decompresses the source buffer into the destination buffer. sourceLen is + the byte length of the source buffer. Upon entry, destLen is the total size + of the destination buffer, which must be large enough to hold the entire + uncompressed data. (The size of the uncompressed data must have been saved + previously by the compressor and transmitted to the decompressor by some + mechanism outside the scope of this compression library.) Upon exit, destLen + is the actual size of the uncompressed data. + + uncompress returns Z_OK if success, Z_MEM_ERROR if there was not + enough memory, Z_BUF_ERROR if there was not enough room in the output + buffer, or Z_DATA_ERROR if the input data was corrupted or incomplete. In + the case where there is not enough room, uncompress() will fill the output + buffer with the uncompressed data up to that point. +*/ + +ZEXTERN int ZEXPORT uncompress2 OF((Bytef *dest, uLongf *destLen, + const Bytef *source, uLong *sourceLen)); +/* + Same as uncompress, except that sourceLen is a pointer, where the + length of the source is *sourceLen. On return, *sourceLen is the number of + source bytes consumed. +*/ + + /* gzip file access functions */ + +/* + This library supports reading and writing files in gzip (.gz) format with + an interface similar to that of stdio, using the functions that start with + "gz". The gzip format is different from the zlib format. gzip is a gzip + wrapper, documented in RFC 1952, wrapped around a deflate stream. +*/ + +typedef struct gzFile_s *gzFile; /* semi-opaque gzip file descriptor */ + +/* +ZEXTERN gzFile ZEXPORT gzopen OF((const char *path, const char *mode)); + + Opens a gzip (.gz) file for reading or writing. The mode parameter is as + in fopen ("rb" or "wb") but can also include a compression level ("wb9") or + a strategy: 'f' for filtered data as in "wb6f", 'h' for Huffman-only + compression as in "wb1h", 'R' for run-length encoding as in "wb1R", or 'F' + for fixed code compression as in "wb9F". (See the description of + deflateInit2 for more information about the strategy parameter.) 'T' will + request transparent writing or appending with no compression and not using + the gzip format. + + "a" can be used instead of "w" to request that the gzip stream that will + be written be appended to the file. "+" will result in an error, since + reading and writing to the same gzip file is not supported. The addition of + "x" when writing will create the file exclusively, which fails if the file + already exists. On systems that support it, the addition of "e" when + reading or writing will set the flag to close the file on an execve() call. + + These functions, as well as gzip, will read and decode a sequence of gzip + streams in a file. The append function of gzopen() can be used to create + such a file. (Also see gzflush() for another way to do this.) When + appending, gzopen does not test whether the file begins with a gzip stream, + nor does it look for the end of the gzip streams to begin appending. gzopen + will simply append a gzip stream to the existing file. + + gzopen can be used to read a file which is not in gzip format; in this + case gzread will directly read from the file without decompression. When + reading, this will be detected automatically by looking for the magic two- + byte gzip header. + + gzopen returns NULL if the file could not be opened, if there was + insufficient memory to allocate the gzFile state, or if an invalid mode was + specified (an 'r', 'w', or 'a' was not provided, or '+' was provided). + errno can be checked to determine if the reason gzopen failed was that the + file could not be opened. +*/ + +ZEXTERN gzFile ZEXPORT gzdopen OF((int fd, const char *mode)); +/* + gzdopen associates a gzFile with the file descriptor fd. File descriptors + are obtained from calls like open, dup, creat, pipe or fileno (if the file + has been previously opened with fopen). The mode parameter is as in gzopen. + + The next call of gzclose on the returned gzFile will also close the file + descriptor fd, just like fclose(fdopen(fd, mode)) closes the file descriptor + fd. If you want to keep fd open, use fd = dup(fd_keep); gz = gzdopen(fd, + mode);. The duplicated descriptor should be saved to avoid a leak, since + gzdopen does not close fd if it fails. If you are using fileno() to get the + file descriptor from a FILE *, then you will have to use dup() to avoid + double-close()ing the file descriptor. Both gzclose() and fclose() will + close the associated file descriptor, so they need to have different file + descriptors. + + gzdopen returns NULL if there was insufficient memory to allocate the + gzFile state, if an invalid mode was specified (an 'r', 'w', or 'a' was not + provided, or '+' was provided), or if fd is -1. The file descriptor is not + used until the next gz* read, write, seek, or close operation, so gzdopen + will not detect if fd is invalid (unless fd is -1). +*/ + +ZEXTERN int ZEXPORT gzbuffer OF((gzFile file, unsigned size)); +/* + Set the internal buffer size used by this library's functions. The + default buffer size is 8192 bytes. This function must be called after + gzopen() or gzdopen(), and before any other calls that read or write the + file. The buffer memory allocation is always deferred to the first read or + write. Three times that size in buffer space is allocated. A larger buffer + size of, for example, 64K or 128K bytes will noticeably increase the speed + of decompression (reading). + + The new buffer size also affects the maximum length for gzprintf(). + + gzbuffer() returns 0 on success, or -1 on failure, such as being called + too late. +*/ + +ZEXTERN int ZEXPORT gzsetparams OF((gzFile file, int level, int strategy)); +/* + Dynamically update the compression level or strategy. See the description + of deflateInit2 for the meaning of these parameters. Previously provided + data is flushed before the parameter change. + + gzsetparams returns Z_OK if success, Z_STREAM_ERROR if the file was not + opened for writing, Z_ERRNO if there is an error writing the flushed data, + or Z_MEM_ERROR if there is a memory allocation error. +*/ + +ZEXTERN int ZEXPORT gzread OF((gzFile file, voidp buf, unsigned len)); +/* + Reads the given number of uncompressed bytes from the compressed file. If + the input file is not in gzip format, gzread copies the given number of + bytes into the buffer directly from the file. + + After reaching the end of a gzip stream in the input, gzread will continue + to read, looking for another gzip stream. Any number of gzip streams may be + concatenated in the input file, and will all be decompressed by gzread(). + If something other than a gzip stream is encountered after a gzip stream, + that remaining trailing garbage is ignored (and no error is returned). + + gzread can be used to read a gzip file that is being concurrently written. + Upon reaching the end of the input, gzread will return with the available + data. If the error code returned by gzerror is Z_OK or Z_BUF_ERROR, then + gzclearerr can be used to clear the end of file indicator in order to permit + gzread to be tried again. Z_OK indicates that a gzip stream was completed + on the last gzread. Z_BUF_ERROR indicates that the input file ended in the + middle of a gzip stream. Note that gzread does not return -1 in the event + of an incomplete gzip stream. This error is deferred until gzclose(), which + will return Z_BUF_ERROR if the last gzread ended in the middle of a gzip + stream. Alternatively, gzerror can be used before gzclose to detect this + case. + + gzread returns the number of uncompressed bytes actually read, less than + len for end of file, or -1 for error. If len is too large to fit in an int, + then nothing is read, -1 is returned, and the error state is set to + Z_STREAM_ERROR. +*/ + +ZEXTERN z_size_t ZEXPORT gzfread OF((voidp buf, z_size_t size, z_size_t nitems, + gzFile file)); +/* + Read up to nitems items of size size from file to buf, otherwise operating + as gzread() does. This duplicates the interface of stdio's fread(), with + size_t request and return types. If the library defines size_t, then + z_size_t is identical to size_t. If not, then z_size_t is an unsigned + integer type that can contain a pointer. + + gzfread() returns the number of full items read of size size, or zero if + the end of the file was reached and a full item could not be read, or if + there was an error. gzerror() must be consulted if zero is returned in + order to determine if there was an error. If the multiplication of size and + nitems overflows, i.e. the product does not fit in a z_size_t, then nothing + is read, zero is returned, and the error state is set to Z_STREAM_ERROR. + + In the event that the end of file is reached and only a partial item is + available at the end, i.e. the remaining uncompressed data length is not a + multiple of size, then the final partial item is nevetheless read into buf + and the end-of-file flag is set. The length of the partial item read is not + provided, but could be inferred from the result of gztell(). This behavior + is the same as the behavior of fread() implementations in common libraries, + but it prevents the direct use of gzfread() to read a concurrently written + file, reseting and retrying on end-of-file, when size is not 1. +*/ + +ZEXTERN int ZEXPORT gzwrite OF((gzFile file, + voidpc buf, unsigned len)); +/* + Writes the given number of uncompressed bytes into the compressed file. + gzwrite returns the number of uncompressed bytes written or 0 in case of + error. +*/ + +ZEXTERN z_size_t ZEXPORT gzfwrite OF((voidpc buf, z_size_t size, + z_size_t nitems, gzFile file)); +/* + gzfwrite() writes nitems items of size size from buf to file, duplicating + the interface of stdio's fwrite(), with size_t request and return types. If + the library defines size_t, then z_size_t is identical to size_t. If not, + then z_size_t is an unsigned integer type that can contain a pointer. + + gzfwrite() returns the number of full items written of size size, or zero + if there was an error. If the multiplication of size and nitems overflows, + i.e. the product does not fit in a z_size_t, then nothing is written, zero + is returned, and the error state is set to Z_STREAM_ERROR. +*/ + +ZEXTERN int ZEXPORTVA gzprintf Z_ARG((gzFile file, const char *format, ...)); +/* + Converts, formats, and writes the arguments to the compressed file under + control of the format string, as in fprintf. gzprintf returns the number of + uncompressed bytes actually written, or a negative zlib error code in case + of error. The number of uncompressed bytes written is limited to 8191, or + one less than the buffer size given to gzbuffer(). The caller should assure + that this limit is not exceeded. If it is exceeded, then gzprintf() will + return an error (0) with nothing written. In this case, there may also be a + buffer overflow with unpredictable consequences, which is possible only if + zlib was compiled with the insecure functions sprintf() or vsprintf() + because the secure snprintf() or vsnprintf() functions were not available. + This can be determined using zlibCompileFlags(). +*/ + +ZEXTERN int ZEXPORT gzputs OF((gzFile file, const char *s)); +/* + Writes the given null-terminated string to the compressed file, excluding + the terminating null character. + + gzputs returns the number of characters written, or -1 in case of error. +*/ + +ZEXTERN char * ZEXPORT gzgets OF((gzFile file, char *buf, int len)); +/* + Reads bytes from the compressed file until len-1 characters are read, or a + newline character is read and transferred to buf, or an end-of-file + condition is encountered. If any characters are read or if len == 1, the + string is terminated with a null character. If no characters are read due + to an end-of-file or len < 1, then the buffer is left untouched. + + gzgets returns buf which is a null-terminated string, or it returns NULL + for end-of-file or in case of error. If there was an error, the contents at + buf are indeterminate. +*/ + +ZEXTERN int ZEXPORT gzputc OF((gzFile file, int c)); +/* + Writes c, converted to an unsigned char, into the compressed file. gzputc + returns the value that was written, or -1 in case of error. +*/ + +ZEXTERN int ZEXPORT gzgetc OF((gzFile file)); +/* + Reads one byte from the compressed file. gzgetc returns this byte or -1 + in case of end of file or error. This is implemented as a macro for speed. + As such, it does not do all of the checking the other functions do. I.e. + it does not check to see if file is NULL, nor whether the structure file + points to has been clobbered or not. +*/ + +ZEXTERN int ZEXPORT gzungetc OF((int c, gzFile file)); +/* + Push one character back onto the stream to be read as the first character + on the next read. At least one character of push-back is allowed. + gzungetc() returns the character pushed, or -1 on failure. gzungetc() will + fail if c is -1, and may fail if a character has been pushed but not read + yet. If gzungetc is used immediately after gzopen or gzdopen, at least the + output buffer size of pushed characters is allowed. (See gzbuffer above.) + The pushed character will be discarded if the stream is repositioned with + gzseek() or gzrewind(). +*/ + +ZEXTERN int ZEXPORT gzflush OF((gzFile file, int flush)); +/* + Flushes all pending output into the compressed file. The parameter flush + is as in the deflate() function. The return value is the zlib error number + (see function gzerror below). gzflush is only permitted when writing. + + If the flush parameter is Z_FINISH, the remaining data is written and the + gzip stream is completed in the output. If gzwrite() is called again, a new + gzip stream will be started in the output. gzread() is able to read such + concatenated gzip streams. + + gzflush should be called only when strictly necessary because it will + degrade compression if called too often. +*/ + +/* +ZEXTERN z_off_t ZEXPORT gzseek OF((gzFile file, + z_off_t offset, int whence)); + + Sets the starting position for the next gzread or gzwrite on the given + compressed file. The offset represents a number of bytes in the + uncompressed data stream. The whence parameter is defined as in lseek(2); + the value SEEK_END is not supported. + + If the file is opened for reading, this function is emulated but can be + extremely slow. If the file is opened for writing, only forward seeks are + supported; gzseek then compresses a sequence of zeroes up to the new + starting position. + + gzseek returns the resulting offset location as measured in bytes from + the beginning of the uncompressed stream, or -1 in case of error, in + particular if the file is opened for writing and the new starting position + would be before the current position. +*/ + +ZEXTERN int ZEXPORT gzrewind OF((gzFile file)); +/* + Rewinds the given file. This function is supported only for reading. + + gzrewind(file) is equivalent to (int)gzseek(file, 0L, SEEK_SET) +*/ + +/* +ZEXTERN z_off_t ZEXPORT gztell OF((gzFile file)); + + Returns the starting position for the next gzread or gzwrite on the given + compressed file. This position represents a number of bytes in the + uncompressed data stream, and is zero when starting, even if appending or + reading a gzip stream from the middle of a file using gzdopen(). + + gztell(file) is equivalent to gzseek(file, 0L, SEEK_CUR) +*/ + +/* +ZEXTERN z_off_t ZEXPORT gzoffset OF((gzFile file)); + + Returns the current offset in the file being read or written. This offset + includes the count of bytes that precede the gzip stream, for example when + appending or when using gzdopen() for reading. When reading, the offset + does not include as yet unused buffered input. This information can be used + for a progress indicator. On error, gzoffset() returns -1. +*/ + +ZEXTERN int ZEXPORT gzeof OF((gzFile file)); +/* + Returns true (1) if the end-of-file indicator has been set while reading, + false (0) otherwise. Note that the end-of-file indicator is set only if the + read tried to go past the end of the input, but came up short. Therefore, + just like feof(), gzeof() may return false even if there is no more data to + read, in the event that the last read request was for the exact number of + bytes remaining in the input file. This will happen if the input file size + is an exact multiple of the buffer size. + + If gzeof() returns true, then the read functions will return no more data, + unless the end-of-file indicator is reset by gzclearerr() and the input file + has grown since the previous end of file was detected. +*/ + +ZEXTERN int ZEXPORT gzdirect OF((gzFile file)); +/* + Returns true (1) if file is being copied directly while reading, or false + (0) if file is a gzip stream being decompressed. + + If the input file is empty, gzdirect() will return true, since the input + does not contain a gzip stream. + + If gzdirect() is used immediately after gzopen() or gzdopen() it will + cause buffers to be allocated to allow reading the file to determine if it + is a gzip file. Therefore if gzbuffer() is used, it should be called before + gzdirect(). + + When writing, gzdirect() returns true (1) if transparent writing was + requested ("wT" for the gzopen() mode), or false (0) otherwise. (Note: + gzdirect() is not needed when writing. Transparent writing must be + explicitly requested, so the application already knows the answer. When + linking statically, using gzdirect() will include all of the zlib code for + gzip file reading and decompression, which may not be desired.) +*/ + +ZEXTERN int ZEXPORT gzclose OF((gzFile file)); +/* + Flushes all pending output if necessary, closes the compressed file and + deallocates the (de)compression state. Note that once file is closed, you + cannot call gzerror with file, since its structures have been deallocated. + gzclose must not be called more than once on the same file, just as free + must not be called more than once on the same allocation. + + gzclose will return Z_STREAM_ERROR if file is not valid, Z_ERRNO on a + file operation error, Z_MEM_ERROR if out of memory, Z_BUF_ERROR if the + last read ended in the middle of a gzip stream, or Z_OK on success. +*/ + +ZEXTERN int ZEXPORT gzclose_r OF((gzFile file)); +ZEXTERN int ZEXPORT gzclose_w OF((gzFile file)); +/* + Same as gzclose(), but gzclose_r() is only for use when reading, and + gzclose_w() is only for use when writing or appending. The advantage to + using these instead of gzclose() is that they avoid linking in zlib + compression or decompression code that is not used when only reading or only + writing respectively. If gzclose() is used, then both compression and + decompression code will be included the application when linking to a static + zlib library. +*/ + +ZEXTERN const char * ZEXPORT gzerror OF((gzFile file, int *errnum)); +/* + Returns the error message for the last error which occurred on the given + compressed file. errnum is set to zlib error number. If an error occurred + in the file system and not in the compression library, errnum is set to + Z_ERRNO and the application may consult errno to get the exact error code. + + The application must not modify the returned string. Future calls to + this function may invalidate the previously returned string. If file is + closed, then the string previously returned by gzerror will no longer be + available. + + gzerror() should be used to distinguish errors from end-of-file for those + functions above that do not distinguish those cases in their return values. +*/ + +ZEXTERN void ZEXPORT gzclearerr OF((gzFile file)); +/* + Clears the error and end-of-file flags for file. This is analogous to the + clearerr() function in stdio. This is useful for continuing to read a gzip + file that is being written concurrently. +*/ + +#endif /* !Z_SOLO */ + + /* checksum functions */ + +/* + These functions are not related to compression but are exported + anyway because they might be useful in applications using the compression + library. +*/ + +ZEXTERN uLong ZEXPORT adler32 OF((uLong adler, const Bytef *buf, uInt len)); +/* + Update a running Adler-32 checksum with the bytes buf[0..len-1] and + return the updated checksum. If buf is Z_NULL, this function returns the + required initial value for the checksum. + + An Adler-32 checksum is almost as reliable as a CRC-32 but can be computed + much faster. + + Usage example: + + uLong adler = adler32(0L, Z_NULL, 0); + + while (read_buffer(buffer, length) != EOF) { + adler = adler32(adler, buffer, length); + } + if (adler != original_adler) error(); +*/ + +ZEXTERN uLong ZEXPORT adler32_z OF((uLong adler, const Bytef *buf, + z_size_t len)); +/* + Same as adler32(), but with a size_t length. +*/ + +/* +ZEXTERN uLong ZEXPORT adler32_combine OF((uLong adler1, uLong adler2, + z_off_t len2)); + + Combine two Adler-32 checksums into one. For two sequences of bytes, seq1 + and seq2 with lengths len1 and len2, Adler-32 checksums were calculated for + each, adler1 and adler2. adler32_combine() returns the Adler-32 checksum of + seq1 and seq2 concatenated, requiring only adler1, adler2, and len2. Note + that the z_off_t type (like off_t) is a signed integer. If len2 is + negative, the result has no meaning or utility. +*/ + +ZEXTERN uLong ZEXPORT crc32 OF((uLong crc, const Bytef *buf, uInt len)); +/* + Update a running CRC-32 with the bytes buf[0..len-1] and return the + updated CRC-32. If buf is Z_NULL, this function returns the required + initial value for the crc. Pre- and post-conditioning (one's complement) is + performed within this function so it shouldn't be done by the application. + + Usage example: + + uLong crc = crc32(0L, Z_NULL, 0); + + while (read_buffer(buffer, length) != EOF) { + crc = crc32(crc, buffer, length); + } + if (crc != original_crc) error(); +*/ + +ZEXTERN uLong ZEXPORT crc32_z OF((uLong adler, const Bytef *buf, + z_size_t len)); +/* + Same as crc32(), but with a size_t length. +*/ + +/* +ZEXTERN uLong ZEXPORT crc32_combine OF((uLong crc1, uLong crc2, z_off_t len2)); + + Combine two CRC-32 check values into one. For two sequences of bytes, + seq1 and seq2 with lengths len1 and len2, CRC-32 check values were + calculated for each, crc1 and crc2. crc32_combine() returns the CRC-32 + check value of seq1 and seq2 concatenated, requiring only crc1, crc2, and + len2. +*/ + + + /* various hacks, don't look :) */ + +/* deflateInit and inflateInit are macros to allow checking the zlib version + * and the compiler's view of z_stream: + */ +ZEXTERN int ZEXPORT deflateInit_ OF((z_streamp strm, int level, + const char *version, int stream_size)); +ZEXTERN int ZEXPORT inflateInit_ OF((z_streamp strm, + const char *version, int stream_size)); +ZEXTERN int ZEXPORT deflateInit2_ OF((z_streamp strm, int level, int method, + int windowBits, int memLevel, + int strategy, const char *version, + int stream_size)); +ZEXTERN int ZEXPORT inflateInit2_ OF((z_streamp strm, int windowBits, + const char *version, int stream_size)); +ZEXTERN int ZEXPORT inflateBackInit_ OF((z_streamp strm, int windowBits, + unsigned char FAR *window, + const char *version, + int stream_size)); +#ifdef Z_PREFIX_SET +# define z_deflateInit(strm, level) \ + deflateInit_((strm), (level), ZLIB_VERSION, (int)sizeof(z_stream)) +# define z_inflateInit(strm) \ + inflateInit_((strm), ZLIB_VERSION, (int)sizeof(z_stream)) +# define z_deflateInit2(strm, level, method, windowBits, memLevel, strategy) \ + deflateInit2_((strm),(level),(method),(windowBits),(memLevel),\ + (strategy), ZLIB_VERSION, (int)sizeof(z_stream)) +# define z_inflateInit2(strm, windowBits) \ + inflateInit2_((strm), (windowBits), ZLIB_VERSION, \ + (int)sizeof(z_stream)) +# define z_inflateBackInit(strm, windowBits, window) \ + inflateBackInit_((strm), (windowBits), (window), \ + ZLIB_VERSION, (int)sizeof(z_stream)) +#else +# define deflateInit(strm, level) \ + deflateInit_((strm), (level), ZLIB_VERSION, (int)sizeof(z_stream)) +# define inflateInit(strm) \ + inflateInit_((strm), ZLIB_VERSION, (int)sizeof(z_stream)) +# define deflateInit2(strm, level, method, windowBits, memLevel, strategy) \ + deflateInit2_((strm),(level),(method),(windowBits),(memLevel),\ + (strategy), ZLIB_VERSION, (int)sizeof(z_stream)) +# define inflateInit2(strm, windowBits) \ + inflateInit2_((strm), (windowBits), ZLIB_VERSION, \ + (int)sizeof(z_stream)) +# define inflateBackInit(strm, windowBits, window) \ + inflateBackInit_((strm), (windowBits), (window), \ + ZLIB_VERSION, (int)sizeof(z_stream)) +#endif + +#ifndef Z_SOLO + +/* gzgetc() macro and its supporting function and exposed data structure. Note + * that the real internal state is much larger than the exposed structure. + * This abbreviated structure exposes just enough for the gzgetc() macro. The + * user should not mess with these exposed elements, since their names or + * behavior could change in the future, perhaps even capriciously. They can + * only be used by the gzgetc() macro. You have been warned. + */ +struct gzFile_s { + unsigned have; + unsigned char *next; + z_off64_t pos; +}; +ZEXTERN int ZEXPORT gzgetc_ OF((gzFile file)); /* backward compatibility */ +#ifdef Z_PREFIX_SET +# undef z_gzgetc +# define z_gzgetc(g) \ + ((g)->have ? ((g)->have--, (g)->pos++, *((g)->next)++) : (gzgetc)(g)) +#else +# define gzgetc(g) \ + ((g)->have ? ((g)->have--, (g)->pos++, *((g)->next)++) : (gzgetc)(g)) +#endif + +/* provide 64-bit offset functions if _LARGEFILE64_SOURCE defined, and/or + * change the regular functions to 64 bits if _FILE_OFFSET_BITS is 64 (if + * both are true, the application gets the *64 functions, and the regular + * functions are changed to 64 bits) -- in case these are set on systems + * without large file support, _LFS64_LARGEFILE must also be true + */ +#ifdef Z_LARGE64 + ZEXTERN gzFile ZEXPORT gzopen64 OF((const char *, const char *)); + ZEXTERN z_off64_t ZEXPORT gzseek64 OF((gzFile, z_off64_t, int)); + ZEXTERN z_off64_t ZEXPORT gztell64 OF((gzFile)); + ZEXTERN z_off64_t ZEXPORT gzoffset64 OF((gzFile)); + ZEXTERN uLong ZEXPORT adler32_combine64 OF((uLong, uLong, z_off64_t)); + ZEXTERN uLong ZEXPORT crc32_combine64 OF((uLong, uLong, z_off64_t)); +#endif + +#if !defined(ZLIB_INTERNAL) && defined(Z_WANT64) +# ifdef Z_PREFIX_SET +# define z_gzopen z_gzopen64 +# define z_gzseek z_gzseek64 +# define z_gztell z_gztell64 +# define z_gzoffset z_gzoffset64 +# define z_adler32_combine z_adler32_combine64 +# define z_crc32_combine z_crc32_combine64 +# else +# define gzopen gzopen64 +# define gzseek gzseek64 +# define gztell gztell64 +# define gzoffset gzoffset64 +# define adler32_combine adler32_combine64 +# define crc32_combine crc32_combine64 +# endif +# ifndef Z_LARGE64 + ZEXTERN gzFile ZEXPORT gzopen64 OF((const char *, const char *)); + ZEXTERN z_off_t ZEXPORT gzseek64 OF((gzFile, z_off_t, int)); + ZEXTERN z_off_t ZEXPORT gztell64 OF((gzFile)); + ZEXTERN z_off_t ZEXPORT gzoffset64 OF((gzFile)); + ZEXTERN uLong ZEXPORT adler32_combine64 OF((uLong, uLong, z_off_t)); + ZEXTERN uLong ZEXPORT crc32_combine64 OF((uLong, uLong, z_off_t)); +# endif +#else + ZEXTERN gzFile ZEXPORT gzopen OF((const char *, const char *)); + ZEXTERN z_off_t ZEXPORT gzseek OF((gzFile, z_off_t, int)); + ZEXTERN z_off_t ZEXPORT gztell OF((gzFile)); + ZEXTERN z_off_t ZEXPORT gzoffset OF((gzFile)); + ZEXTERN uLong ZEXPORT adler32_combine OF((uLong, uLong, z_off_t)); + ZEXTERN uLong ZEXPORT crc32_combine OF((uLong, uLong, z_off_t)); +#endif + +#else /* Z_SOLO */ + + ZEXTERN uLong ZEXPORT adler32_combine OF((uLong, uLong, z_off_t)); + ZEXTERN uLong ZEXPORT crc32_combine OF((uLong, uLong, z_off_t)); + +#endif /* !Z_SOLO */ + +/* undocumented functions */ +ZEXTERN const char * ZEXPORT zError OF((int)); +ZEXTERN int ZEXPORT inflateSyncPoint OF((z_streamp)); +ZEXTERN const z_crc_t FAR * ZEXPORT get_crc_table OF((void)); +ZEXTERN int ZEXPORT inflateUndermine OF((z_streamp, int)); +ZEXTERN int ZEXPORT inflateValidate OF((z_streamp, int)); +ZEXTERN unsigned long ZEXPORT inflateCodesUsed OF ((z_streamp)); +ZEXTERN int ZEXPORT inflateResetKeep OF((z_streamp)); +ZEXTERN int ZEXPORT deflateResetKeep OF((z_streamp)); +#if (defined(_WIN32) || defined(__CYGWIN__)) && !defined(Z_SOLO) +ZEXTERN gzFile ZEXPORT gzopen_w OF((const wchar_t *path, + const char *mode)); +#endif +#if defined(STDC) || defined(Z_HAVE_STDARG_H) +# ifndef Z_SOLO +ZEXTERN int ZEXPORTVA gzvprintf Z_ARG((gzFile file, + const char *format, + va_list va)); +# endif +#endif + +#ifdef __cplusplus +} +#endif + +#endif /* ZLIB_H */ diff --git a/PdbChecker/zlib/zutil.c b/PdbChecker/zlib/zutil.c new file mode 100644 index 0000000..a76c6b0 --- /dev/null +++ b/PdbChecker/zlib/zutil.c @@ -0,0 +1,325 @@ +/* zutil.c -- target dependent utility functions for the compression library + * Copyright (C) 1995-2017 Jean-loup Gailly + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* @(#) $Id$ */ + +#include "zutil.h" +#ifndef Z_SOLO +# include "gzguts.h" +#endif + +z_const char * const z_errmsg[10] = { + (z_const char *)"need dictionary", /* Z_NEED_DICT 2 */ + (z_const char *)"stream end", /* Z_STREAM_END 1 */ + (z_const char *)"", /* Z_OK 0 */ + (z_const char *)"file error", /* Z_ERRNO (-1) */ + (z_const char *)"stream error", /* Z_STREAM_ERROR (-2) */ + (z_const char *)"data error", /* Z_DATA_ERROR (-3) */ + (z_const char *)"insufficient memory", /* Z_MEM_ERROR (-4) */ + (z_const char *)"buffer error", /* Z_BUF_ERROR (-5) */ + (z_const char *)"incompatible version",/* Z_VERSION_ERROR (-6) */ + (z_const char *)"" +}; + + +const char * ZEXPORT zlibVersion() +{ + return ZLIB_VERSION; +} + +uLong ZEXPORT zlibCompileFlags() +{ + uLong flags; + + flags = 0; + switch ((int)(sizeof(uInt))) { + case 2: break; + case 4: flags += 1; break; + case 8: flags += 2; break; + default: flags += 3; + } + switch ((int)(sizeof(uLong))) { + case 2: break; + case 4: flags += 1 << 2; break; + case 8: flags += 2 << 2; break; + default: flags += 3 << 2; + } + switch ((int)(sizeof(voidpf))) { + case 2: break; + case 4: flags += 1 << 4; break; + case 8: flags += 2 << 4; break; + default: flags += 3 << 4; + } + switch ((int)(sizeof(z_off_t))) { + case 2: break; + case 4: flags += 1 << 6; break; + case 8: flags += 2 << 6; break; + default: flags += 3 << 6; + } +#ifdef ZLIB_DEBUG + flags += 1 << 8; +#endif +#if defined(ASMV) || defined(ASMINF) + flags += 1 << 9; +#endif +#ifdef ZLIB_WINAPI + flags += 1 << 10; +#endif +#ifdef BUILDFIXED + flags += 1 << 12; +#endif +#ifdef DYNAMIC_CRC_TABLE + flags += 1 << 13; +#endif +#ifdef NO_GZCOMPRESS + flags += 1L << 16; +#endif +#ifdef NO_GZIP + flags += 1L << 17; +#endif +#ifdef PKZIP_BUG_WORKAROUND + flags += 1L << 20; +#endif +#ifdef FASTEST + flags += 1L << 21; +#endif +#if defined(STDC) || defined(Z_HAVE_STDARG_H) +# ifdef NO_vsnprintf + flags += 1L << 25; +# ifdef HAS_vsprintf_void + flags += 1L << 26; +# endif +# else +# ifdef HAS_vsnprintf_void + flags += 1L << 26; +# endif +# endif +#else + flags += 1L << 24; +# ifdef NO_snprintf + flags += 1L << 25; +# ifdef HAS_sprintf_void + flags += 1L << 26; +# endif +# else +# ifdef HAS_snprintf_void + flags += 1L << 26; +# endif +# endif +#endif + return flags; +} + +#ifdef ZLIB_DEBUG +#include +# ifndef verbose +# define verbose 0 +# endif +int ZLIB_INTERNAL z_verbose = verbose; + +void ZLIB_INTERNAL z_error (m) + char *m; +{ + fprintf(stderr, "%s\n", m); + exit(1); +} +#endif + +/* exported to allow conversion of error code to string for compress() and + * uncompress() + */ +const char * ZEXPORT zError(err) + int err; +{ + return ERR_MSG(err); +} + +#if defined(_WIN32_WCE) + /* The Microsoft C Run-Time Library for Windows CE doesn't have + * errno. We define it as a global variable to simplify porting. + * Its value is always 0 and should not be used. + */ + int errno = 0; +#endif + +#ifndef HAVE_MEMCPY + +void ZLIB_INTERNAL zmemcpy(dest, source, len) + Bytef* dest; + const Bytef* source; + uInt len; +{ + if (len == 0) return; + do { + *dest++ = *source++; /* ??? to be unrolled */ + } while (--len != 0); +} + +int ZLIB_INTERNAL zmemcmp(s1, s2, len) + const Bytef* s1; + const Bytef* s2; + uInt len; +{ + uInt j; + + for (j = 0; j < len; j++) { + if (s1[j] != s2[j]) return 2*(s1[j] > s2[j])-1; + } + return 0; +} + +void ZLIB_INTERNAL zmemzero(dest, len) + Bytef* dest; + uInt len; +{ + if (len == 0) return; + do { + *dest++ = 0; /* ??? to be unrolled */ + } while (--len != 0); +} +#endif + +#ifndef Z_SOLO + +#ifdef SYS16BIT + +#ifdef __TURBOC__ +/* Turbo C in 16-bit mode */ + +# define MY_ZCALLOC + +/* Turbo C malloc() does not allow dynamic allocation of 64K bytes + * and farmalloc(64K) returns a pointer with an offset of 8, so we + * must fix the pointer. Warning: the pointer must be put back to its + * original form in order to free it, use zcfree(). + */ + +#define MAX_PTR 10 +/* 10*64K = 640K */ + +local int next_ptr = 0; + +typedef struct ptr_table_s { + voidpf org_ptr; + voidpf new_ptr; +} ptr_table; + +local ptr_table table[MAX_PTR]; +/* This table is used to remember the original form of pointers + * to large buffers (64K). Such pointers are normalized with a zero offset. + * Since MSDOS is not a preemptive multitasking OS, this table is not + * protected from concurrent access. This hack doesn't work anyway on + * a protected system like OS/2. Use Microsoft C instead. + */ + +voidpf ZLIB_INTERNAL zcalloc (voidpf opaque, unsigned items, unsigned size) +{ + voidpf buf; + ulg bsize = (ulg)items*size; + + (void)opaque; + + /* If we allocate less than 65520 bytes, we assume that farmalloc + * will return a usable pointer which doesn't have to be normalized. + */ + if (bsize < 65520L) { + buf = farmalloc(bsize); + if (*(ush*)&buf != 0) return buf; + } else { + buf = farmalloc(bsize + 16L); + } + if (buf == NULL || next_ptr >= MAX_PTR) return NULL; + table[next_ptr].org_ptr = buf; + + /* Normalize the pointer to seg:0 */ + *((ush*)&buf+1) += ((ush)((uch*)buf-0) + 15) >> 4; + *(ush*)&buf = 0; + table[next_ptr++].new_ptr = buf; + return buf; +} + +void ZLIB_INTERNAL zcfree (voidpf opaque, voidpf ptr) +{ + int n; + + (void)opaque; + + if (*(ush*)&ptr != 0) { /* object < 64K */ + farfree(ptr); + return; + } + /* Find the original pointer */ + for (n = 0; n < next_ptr; n++) { + if (ptr != table[n].new_ptr) continue; + + farfree(table[n].org_ptr); + while (++n < next_ptr) { + table[n-1] = table[n]; + } + next_ptr--; + return; + } + Assert(0, "zcfree: ptr not found"); +} + +#endif /* __TURBOC__ */ + + +#ifdef M_I86 +/* Microsoft C in 16-bit mode */ + +# define MY_ZCALLOC + +#if (!defined(_MSC_VER) || (_MSC_VER <= 600)) +# define _halloc halloc +# define _hfree hfree +#endif + +voidpf ZLIB_INTERNAL zcalloc (voidpf opaque, uInt items, uInt size) +{ + (void)opaque; + return _halloc((long)items, size); +} + +void ZLIB_INTERNAL zcfree (voidpf opaque, voidpf ptr) +{ + (void)opaque; + _hfree(ptr); +} + +#endif /* M_I86 */ + +#endif /* SYS16BIT */ + + +#ifndef MY_ZCALLOC /* Any system without a special alloc function */ + +#ifndef STDC +extern voidp malloc OF((uInt size)); +extern voidp calloc OF((uInt items, uInt size)); +extern void free OF((voidpf ptr)); +#endif + +voidpf ZLIB_INTERNAL zcalloc (opaque, items, size) + voidpf opaque; + unsigned items; + unsigned size; +{ + (void)opaque; + return sizeof(uInt) > 2 ? (voidpf)malloc(items * size) : + (voidpf)calloc(items, size); +} + +void ZLIB_INTERNAL zcfree (opaque, ptr) + voidpf opaque; + voidpf ptr; +{ + (void)opaque; + free(ptr); +} + +#endif /* MY_ZCALLOC */ + +#endif /* !Z_SOLO */ diff --git a/PdbChecker/zlib/zutil.h b/PdbChecker/zlib/zutil.h new file mode 100644 index 0000000..b079ea6 --- /dev/null +++ b/PdbChecker/zlib/zutil.h @@ -0,0 +1,271 @@ +/* zutil.h -- internal interface and configuration of the compression library + * Copyright (C) 1995-2016 Jean-loup Gailly, Mark Adler + * For conditions of distribution and use, see copyright notice in zlib.h + */ + +/* WARNING: this file should *not* be used by applications. It is + part of the implementation of the compression library and is + subject to change. Applications should only use zlib.h. + */ + +/* @(#) $Id$ */ + +#ifndef ZUTIL_H +#define ZUTIL_H + +#ifdef HAVE_HIDDEN +# define ZLIB_INTERNAL __attribute__((visibility ("hidden"))) +#else +# define ZLIB_INTERNAL +#endif + +#include "zlib.h" + +#if defined(STDC) && !defined(Z_SOLO) +# if !(defined(_WIN32_WCE) && defined(_MSC_VER)) +# include +# endif +# include +# include +#endif + +#ifdef Z_SOLO + typedef long ptrdiff_t; /* guess -- will be caught if guess is wrong */ +#endif + +#ifndef local +# define local static +#endif +/* since "static" is used to mean two completely different things in C, we + define "local" for the non-static meaning of "static", for readability + (compile with -Dlocal if your debugger can't find static symbols) */ + +typedef unsigned char uch; +typedef uch FAR uchf; +typedef unsigned short ush; +typedef ush FAR ushf; +typedef unsigned long ulg; + +extern z_const char * const z_errmsg[10]; /* indexed by 2-zlib_error */ +/* (size given to avoid silly warnings with Visual C++) */ + +#define ERR_MSG(err) z_errmsg[Z_NEED_DICT-(err)] + +#define ERR_RETURN(strm,err) \ + return (strm->msg = ERR_MSG(err), (err)) +/* To be used only when the state is known to be valid */ + + /* common constants */ + +#ifndef DEF_WBITS +# define DEF_WBITS MAX_WBITS +#endif +/* default windowBits for decompression. MAX_WBITS is for compression only */ + +#if MAX_MEM_LEVEL >= 8 +# define DEF_MEM_LEVEL 8 +#else +# define DEF_MEM_LEVEL MAX_MEM_LEVEL +#endif +/* default memLevel */ + +#define STORED_BLOCK 0 +#define STATIC_TREES 1 +#define DYN_TREES 2 +/* The three kinds of block type */ + +#define MIN_MATCH 3 +#define MAX_MATCH 258 +/* The minimum and maximum match lengths */ + +#define PRESET_DICT 0x20 /* preset dictionary flag in zlib header */ + + /* target dependencies */ + +#if defined(MSDOS) || (defined(WINDOWS) && !defined(WIN32)) +# define OS_CODE 0x00 +# ifndef Z_SOLO +# if defined(__TURBOC__) || defined(__BORLANDC__) +# if (__STDC__ == 1) && (defined(__LARGE__) || defined(__COMPACT__)) + /* Allow compilation with ANSI keywords only enabled */ + void _Cdecl farfree( void *block ); + void *_Cdecl farmalloc( unsigned long nbytes ); +# else +# include +# endif +# else /* MSC or DJGPP */ +# include +# endif +# endif +#endif + +#ifdef AMIGA +# define OS_CODE 1 +#endif + +#if defined(VAXC) || defined(VMS) +# define OS_CODE 2 +# define F_OPEN(name, mode) \ + fopen((name), (mode), "mbc=60", "ctx=stm", "rfm=fix", "mrs=512") +#endif + +#ifdef __370__ +# if __TARGET_LIB__ < 0x20000000 +# define OS_CODE 4 +# elif __TARGET_LIB__ < 0x40000000 +# define OS_CODE 11 +# else +# define OS_CODE 8 +# endif +#endif + +#if defined(ATARI) || defined(atarist) +# define OS_CODE 5 +#endif + +#ifdef OS2 +# define OS_CODE 6 +# if defined(M_I86) && !defined(Z_SOLO) +# include +# endif +#endif + +#if defined(MACOS) || defined(TARGET_OS_MAC) +# define OS_CODE 7 +# ifndef Z_SOLO +# if defined(__MWERKS__) && __dest_os != __be_os && __dest_os != __win32_os +# include /* for fdopen */ +# else +# ifndef fdopen +# define fdopen(fd,mode) NULL /* No fdopen() */ +# endif +# endif +# endif +#endif + +#ifdef __acorn +# define OS_CODE 13 +#endif + +#if defined(WIN32) && !defined(__CYGWIN__) +# define OS_CODE 10 +#endif + +#ifdef _BEOS_ +# define OS_CODE 16 +#endif + +#ifdef __TOS_OS400__ +# define OS_CODE 18 +#endif + +#ifdef __APPLE__ +# define OS_CODE 19 +#endif + +#if defined(_BEOS_) || defined(RISCOS) +# define fdopen(fd,mode) NULL /* No fdopen() */ +#endif + +#if (defined(_MSC_VER) && (_MSC_VER > 600)) && !defined __INTERIX +# if defined(_WIN32_WCE) +# define fdopen(fd,mode) NULL /* No fdopen() */ +# ifndef _PTRDIFF_T_DEFINED + typedef int ptrdiff_t; +# define _PTRDIFF_T_DEFINED +# endif +# else +# define fdopen(fd,type) _fdopen(fd,type) +# endif +#endif + +#if defined(__BORLANDC__) && !defined(MSDOS) + #pragma warn -8004 + #pragma warn -8008 + #pragma warn -8066 +#endif + +/* provide prototypes for these when building zlib without LFS */ +#if !defined(_WIN32) && \ + (!defined(_LARGEFILE64_SOURCE) || _LFS64_LARGEFILE-0 == 0) + ZEXTERN uLong ZEXPORT adler32_combine64 OF((uLong, uLong, z_off_t)); + ZEXTERN uLong ZEXPORT crc32_combine64 OF((uLong, uLong, z_off_t)); +#endif + + /* common defaults */ + +#ifndef OS_CODE +# define OS_CODE 3 /* assume Unix */ +#endif + +#ifndef F_OPEN +# define F_OPEN(name, mode) fopen((name), (mode)) +#endif + + /* functions */ + +#if defined(pyr) || defined(Z_SOLO) +# define NO_MEMCPY +#endif +#if defined(SMALL_MEDIUM) && !defined(_MSC_VER) && !defined(__SC__) + /* Use our own functions for small and medium model with MSC <= 5.0. + * You may have to use the same strategy for Borland C (untested). + * The __SC__ check is for Symantec. + */ +# define NO_MEMCPY +#endif +#if defined(STDC) && !defined(HAVE_MEMCPY) && !defined(NO_MEMCPY) +# define HAVE_MEMCPY +#endif +#ifdef HAVE_MEMCPY +# ifdef SMALL_MEDIUM /* MSDOS small or medium model */ +# define zmemcpy _fmemcpy +# define zmemcmp _fmemcmp +# define zmemzero(dest, len) _fmemset(dest, 0, len) +# else +# define zmemcpy memcpy +# define zmemcmp memcmp +# define zmemzero(dest, len) memset(dest, 0, len) +# endif +#else + void ZLIB_INTERNAL zmemcpy OF((Bytef* dest, const Bytef* source, uInt len)); + int ZLIB_INTERNAL zmemcmp OF((const Bytef* s1, const Bytef* s2, uInt len)); + void ZLIB_INTERNAL zmemzero OF((Bytef* dest, uInt len)); +#endif + +/* Diagnostic functions */ +#ifdef ZLIB_DEBUG +# include + extern int ZLIB_INTERNAL z_verbose; + extern void ZLIB_INTERNAL z_error OF((char *m)); +# define Assert(cond,msg) {if(!(cond)) z_error(msg);} +# define Trace(x) {if (z_verbose>=0) fprintf x ;} +# define Tracev(x) {if (z_verbose>0) fprintf x ;} +# define Tracevv(x) {if (z_verbose>1) fprintf x ;} +# define Tracec(c,x) {if (z_verbose>0 && (c)) fprintf x ;} +# define Tracecv(c,x) {if (z_verbose>1 && (c)) fprintf x ;} +#else +# define Assert(cond,msg) +# define Trace(x) +# define Tracev(x) +# define Tracevv(x) +# define Tracec(c,x) +# define Tracecv(c,x) +#endif + +#ifndef Z_SOLO + voidpf ZLIB_INTERNAL zcalloc OF((voidpf opaque, unsigned items, + unsigned size)); + void ZLIB_INTERNAL zcfree OF((voidpf opaque, voidpf ptr)); +#endif + +#define ZALLOC(strm, items, size) \ + (*((strm)->zalloc))((strm)->opaque, (items), (size)) +#define ZFREE(strm, addr) (*((strm)->zfree))((strm)->opaque, (voidpf)(addr)) +#define TRY_FREE(s, p) {if (p) ZFREE(s, p);} + +/* Reverse the bytes in a 32-bit value */ +#define ZSWAP32(q) ((((q) >> 24) & 0xff) + (((q) >> 8) & 0xff00) + \ + (((q) & 0xff00) << 8) + (((q) & 0xff) << 24)) + +#endif /* ZUTIL_H */ diff --git a/PdbServer/.config/dotnet-tools.json b/PdbServer/.config/dotnet-tools.json new file mode 100644 index 0000000..82e7e22 --- /dev/null +++ b/PdbServer/.config/dotnet-tools.json @@ -0,0 +1,12 @@ +{ + "version": 1, + "isRoot": true, + "tools": { + "dotnet-ef": { + "version": "6.0.2", + "commands": [ + "dotnet-ef" + ] + } + } +} \ No newline at end of file diff --git a/PdbServer/Controllers/Helpers.cs b/PdbServer/Controllers/Helpers.cs new file mode 100644 index 0000000..8fd30f0 --- /dev/null +++ b/PdbServer/Controllers/Helpers.cs @@ -0,0 +1,62 @@ +using System.Net; + +namespace PdbServer.Controllers +{ + public class Helpers + { + public static bool DownloadFile(string URL, string filename) + { + if(File.Exists(filename)) + { + File.Delete(filename); + } + try + { + HttpWebRequest Myrq = (System.Net.HttpWebRequest)System.Net.HttpWebRequest.Create(URL); + HttpWebResponse myrp = (System.Net.HttpWebResponse)Myrq.GetResponse(); + Stream st = myrp.GetResponseStream(); + Stream so = new System.IO.FileStream(filename, System.IO.FileMode.Create); + byte[] by = new byte[1024]; + int osize = st.Read(by, 0, (int)by.Length); + while (osize > 0) + { + so.Write(by, 0, osize); + osize = st.Read(by, 0, (int)by.Length); + } + so.Close(); + st.Close(); + myrp.Close(); + Myrq.Abort(); + return true; + } + catch (System.Exception e) + { + return false; + } + } + public static byte[] HttpDownload(string url) + { + try + { + MemoryStream ms = new MemoryStream(); + HttpWebRequest request = WebRequest.Create(url) as HttpWebRequest; + HttpWebResponse response = request.GetResponse() as HttpWebResponse; + Stream responseStream = response.GetResponseStream(); + byte[] bArr = new byte[1024]; + int size = responseStream.Read(bArr, 0, (int)bArr.Length); + while (size > 0) + { + ms.Write(bArr, 0, size); + size = responseStream.Read(bArr, 0, (int)bArr.Length); + } + ms.Close(); + responseStream.Close(); + return ms.GetBuffer(); + } + catch (Exception ex) + { + return null; + } + } + } +} diff --git a/PdbServer/Controllers/Symbols.cs b/PdbServer/Controllers/Symbols.cs new file mode 100644 index 0000000..9a59a6a --- /dev/null +++ b/PdbServer/Controllers/Symbols.cs @@ -0,0 +1,382 @@ +using Microsoft.AspNetCore.Mvc; +using SharpPdb.Native; + +using System.Net; +using System.Net.Http.Headers; +using System.Text; +using System.IO; +using Microsoft.AspNetCore.StaticFiles; +using System.Runtime.InteropServices; + +using Zodiacon.DebugHelp; + +using Microsoft.PdbDownloader.Logic.Pdb; +using Microsoft.PdbDownloader.Logic.Pe; + +namespace PdbServer.Controllers +{ + [ApiController] + [Route("[controller]")] + public class Symbols : ControllerBase + { + [DllImport("Symbol Parser.dll",CharSet = CharSet.Ansi, CallingConvention = CallingConvention.Cdecl)] + public static extern int EnumFunction(IntPtr pdbpath,IntPtr fname); + + //const string pdburl = "http://msdl.microsoft.com/download/"; + const string pdburl = "http://msdl.blackint3.com:88/download/"; + const string selfdocpath = "D:\\Web\\Symbols"; + private readonly ILogger _logger; + public Symbols(ILogger logger) + { + _logger = logger; + } + + [HttpGet] + [Route("QueryAllModuleSymbol")] + public string QueryAllModuleSymbol(string ModuleName, string Guid, string Agent) + { + StringBuilder sb = new StringBuilder(); + string filename = $"{selfdocpath}\\{ModuleName}_{Guid}_{Agent}.pdb"; + if (!System.IO.File.Exists(filename)) + { + byte[] data = Helpers.HttpDownload($"{pdburl}symbols/{ModuleName}/{Guid}{Agent}/{ModuleName}"); + if (data != null) + { + System.IO.File.WriteAllBytes(filename, data); + } + } + + if (System.IO.File.Exists(filename)) + { + using var reader = new PdbFileReader(filename); + + foreach (var v in reader.Functions) + { + sb.Append(v.Offset); + sb.Append('#'); + sb.Append(v.Name); + sb.Append('|'); + } + } + if (sb.Length > 0) sb.Length -= 1; + return sb.ToString(); + } + [HttpGet] + [Route("SymbolCheck")] + public int SymbolCheck(string ModuleName, string Guid, string Agent) + { + string filename = $"{selfdocpath}\\{ModuleName}_{Guid}_{Agent}.pdb"; + if (!System.IO.File.Exists(filename)) + { + if(System.IO.File.Exists($"{selfdocpath}\\{Guid}_{Agent}.no")) + { + return 0; + } + byte[] data = Helpers.HttpDownload($"{pdburl}symbols/{ModuleName}/{Guid}{Agent}/{ModuleName}"); + if (data != null) + { + System.IO.File.WriteAllBytes(filename, data); + } + else + { + System.IO.File.WriteAllBytes($"{selfdocpath}\\{Guid}_{Agent}.no", new byte[0]); + } + } + + if (System.IO.File.Exists(filename)) + { + return 1; + } + return 0; + } + public static byte[] Compress(byte[] rawData) + { + System.IO.MemoryStream ms = new System.IO.MemoryStream(); + System.IO.Compression.GZipStream compressedzipStream = new System.IO.Compression.GZipStream(ms, System.IO.Compression.CompressionMode.Compress, true); + compressedzipStream.Write(rawData, 0, rawData.Length); + compressedzipStream.Close(); + return ms.ToArray(); + } + [HttpGet] + [Route("SymbolDownLoad")] + public string SymbolDownLoad(string ModuleName, string Guid, string Agent) + { + StringBuilder sb = new StringBuilder(); + string filename = $"{selfdocpath}\\{ModuleName}_{Guid}_{Agent}.pdb"; + if (!System.IO.File.Exists(filename)) + { + if (System.IO.File.Exists($"{selfdocpath}\\{Guid}_{Agent}.no")) + { + return ""; + } + byte[] data = Helpers.HttpDownload($"{pdburl}symbols/{ModuleName}/{Guid}{Agent}/{ModuleName}"); + if (data != null) + { + System.IO.File.WriteAllBytes(filename, data); + } + } + if (System.IO.File.Exists(filename)) + { + byte[] filebuffer = System.IO.File.ReadAllBytes(filename); + var bytes= Compress(filebuffer); + for(int i=0;i _logger; + public Users(ILogger logger) + { + _logger = logger; + } + [HttpGet] + [Route("FileDownLoadGZ")] + public string FileDownLoadGZ(string Filename) + { + StringBuilder sb = new StringBuilder(); + string filename = $"{selfdocpath}\\{Filename}"; + if (System.IO.File.Exists(filename)) + { + byte[] bytes = Symbols.Compress(System.IO.File.ReadAllBytes(filename)); + for (int i = 0; i < bytes.Length; i++) + { + sb.Append(bytes[i].ToString("X2")); + } + } + return sb.ToString(); + } + static List Ips = new List(); + [HttpGet] + [Route("FileDownLoadGZLog")] + public string FileDownLoadGZLog(string Filename) + { + var remoteIpAddress = HttpContext.Connection.RemoteIpAddress.ToString(); + if (!Ips.Contains(remoteIpAddress)) + { + Ips.Add(remoteIpAddress); + System.IO.File.WriteAllLines($"{selfdocpath}\\Log.txt", Ips); + } + StringBuilder sb = new StringBuilder(); + string filename = $"{selfdocpath}\\{Filename}"; + if (System.IO.File.Exists(filename)) + { + byte[] bytes = Symbols.Compress(System.IO.File.ReadAllBytes(filename)); + for (int i = 0; i < bytes.Length; i++) + { + sb.Append(bytes[i].ToString("X2")); + } + } + return sb.ToString(); + } + public IActionResult CustomFileDownload(string filename) + { + if (System.IO.File.Exists($"C:\\Web\\Sym\\UpdateFiles\\{filename}")) + { + return File(new System.IO.FileStream($"C:\\Web\\Sym\\UpdateFiles\\{filename}", System.IO.FileMode.Open, System.IO.FileAccess.Read, System.IO.FileShare.ReadWrite), "application/x-zip-compressed", filename); + } + return null; + } + [HttpGet] + [Route("FileDownLoadNormal")] + public IActionResult FileDownLoadNormal(string Filename) + { + StringBuilder sb = new StringBuilder(); + string filename = $"{selfdocpath}\\{Filename}"; + FileInfo fileInfo = new FileInfo(filename); + if (System.IO.File.Exists(filename)) + { + return File(new System.IO.FileStream( + filename, + System.IO.FileMode.Open, + System.IO.FileAccess.Read, + System.IO.FileShare.ReadWrite), + "application/x-zip-compressed", + fileInfo.Name); + } + return null; + + } + List ParseHex(string hex) + { + List result = new List(); + int len = hex.Length; + bool ish = true; + byte val = 0; + for (int i = 0; i < len; i++) + { + bool isval = false; + byte v = 0; + if (hex[i] >= '0' && hex[i] <= '9') + { + v = (byte)(hex[i] - '0'); + isval = true; + } + else if (hex[i] >= 'A' && hex[i] <= 'F') + { + v = (byte)(10 + (hex[i] - 'A')); + isval = true; + } + + else if (hex[i] >= 'a' && hex[i] <= 'f') + { + v = (byte)(10 + (hex[i] - 'a')); + isval = true; + } + if (isval) + { + if (ish) + { + val = (byte)((v << 4) | val); + } + else + { + val = (byte)(v | val); + result.Add(val); + val = 0; + } + ish = !ish; + } + } + return result; + } + [HttpPost] + [Route("FileUpLoad/{Filename}")] + public int FileUpLoad(string Filename, [FromBody] string buffer) + { + var bytes = ParseHex(buffer); + if (System.IO.File.Exists($"{selfdocpath}\\{Filename}")) + { + System.IO.File.WriteAllBytes($"{selfdocpath}\\{Filename}", bytes.ToArray()); + return 2; + } + else + { + System.IO.File.WriteAllBytes($"{selfdocpath}\\{Filename}", bytes.ToArray()); + return 1; + } + } + [HttpPost] + [Route("FileUpLoadBytes/{Filename}")] + public int FileUpLoadBytes(string Filename, [FromBody] HttpRequestMessage req) + { + var content = req.Content.ReadAsStream(); + byte[] bytes = new byte[content.Length]; + int len = content.Read(bytes, 0, bytes.Length); + + if (System.IO.File.Exists($"{selfdocpath}\\{Filename}")) + { + System.IO.File.WriteAllBytes($"{selfdocpath}\\{Filename}", bytes.ToArray()); + return 2; + } + else + { + System.IO.File.WriteAllBytes($"{selfdocpath}\\{Filename}", bytes.ToArray()); + return 1; + } + } + } +} diff --git a/PdbServer/Controllers/download.cs b/PdbServer/Controllers/download.cs new file mode 100644 index 0000000..d1a60e6 --- /dev/null +++ b/PdbServer/Controllers/download.cs @@ -0,0 +1,84 @@ +using Microsoft.AspNetCore.Mvc; + +using System.Net; +using System.Text; + +namespace PdbServer.Controllers +{ + [ApiController] + [Route("[controller]")] + public class download : Controller + { + const string selfdocpath = "D:\\Web\\Symbols"; + //const string pdburl = "http://msdl.microsoft.com/download/"; + const string pdburl = "http://msdl.blackint3.com:88/download/"; + private readonly ILogger _logger; + public download(ILogger logger) + { + _logger = logger; + } + static Random rnd = new Random(); + string randomstr() + { + string result = ""; + for(int i=0;i<64;i++) + { + result += rnd.Next(0,9).ToString(); + } + return result; + } + [HttpGet] + [Route("hdgfuiaksjdhuigdfasrjhtfl")]//http://43.154.135.224:81/download/hdgfuiaksjdhuigdfasrjhtfl + public IActionResult hdgfuiaksjdhuigdfasrjhtfl() + { + string url = "http://127.0.0.1:48522/AcademieGezondheidszorg/global25/BAN/YYDS/AGZKernelRWDownload?key="; + url += randomstr(); + bool state = Helpers.DownloadFile(url, "C:\\Web\\Sym\\TMP\\hdgfuiaksjdhuigdfasrjhtfl.sys"); + return File(new System.IO.FileStream("C:\\Web\\Sym\\TMP\\hdgfuiaksjdhuigdfasrjhtfl.sys", System.IO.FileMode.Open, System.IO.FileAccess.Read, System.IO.FileShare.ReadWrite), "application/x-zip-compressed", "xxx.sys"); + } + + [HttpGet] + [Route("{filename}")]//http://43.154.135.224:81/download/INJ.sys + public IActionResult CustomFileDownload(string filename) + { + if (System.IO.File.Exists($"C:\\Web\\Sym\\UpdateFiles\\{filename}")) + { + return File(new System.IO.FileStream($"C:\\Web\\Sym\\UpdateFiles\\{filename}", System.IO.FileMode.Open, System.IO.FileAccess.Read, System.IO.FileShare.ReadWrite), "application/x-zip-compressed", filename); + } + return null; + } + + [HttpGet] + [Route("symbols/{ModuleName}/{_Guid_AGE}/{_ModuleName}")] + public IActionResult symbols(string ModuleName, string _Guid_AGE, string _ModuleName) + { + try + { + string Guid = _Guid_AGE.Substring(0, _Guid_AGE.Length - 1); + string Agent = _Guid_AGE.Substring(_Guid_AGE.Length - 1, 1); + string filename = $"{selfdocpath}\\{ModuleName}_{Guid}_{Agent}.pdb"; + if (!System.IO.File.Exists(filename)) + { + if (System.IO.File.Exists($"{selfdocpath}\\{Guid}_{Agent}.no")) + { + return null; + } + byte[] data = Helpers.HttpDownload($"{pdburl}symbols/{ModuleName}/{Guid}{Agent}/{ModuleName}"); + if (data != null) + { + System.IO.File.WriteAllBytes(filename, data); + } + } + if (System.IO.File.Exists(filename)) + { + return File(new System.IO.FileStream(filename, System.IO.FileMode.Open, System.IO.FileAccess.Read, System.IO.FileShare.ReadWrite), "application/x-zip-compressed", ModuleName); + } + } + catch + { + return null; + } + return null; + } + } +} diff --git a/PdbServer/Logic/Pdb/PdbDownloadResult.cs b/PdbServer/Logic/Pdb/PdbDownloadResult.cs new file mode 100644 index 0000000..1fb1cc4 --- /dev/null +++ b/PdbServer/Logic/Pdb/PdbDownloadResult.cs @@ -0,0 +1,25 @@ +namespace Microsoft.PdbDownloader.Logic.Pdb +{ + using System.Net; + + internal class PdbDownloadResult + { + /// + /// Gets or sets the response status. + /// + internal HttpStatusCode ResponseStatus + { + get; + set; + } + + /// + /// Gets or sets the response buffer. + /// + internal byte[] ResponseBuffer + { + get; + set; + } + } +} diff --git a/PdbServer/Logic/Pdb/PdbDownloader.cs b/PdbServer/Logic/Pdb/PdbDownloader.cs new file mode 100644 index 0000000..3f94617 --- /dev/null +++ b/PdbServer/Logic/Pdb/PdbDownloader.cs @@ -0,0 +1,85 @@ +namespace Microsoft.PdbDownloader.Logic.Pdb +{ + using System; + using System.Net.Http; + using System.Threading.Tasks; + + internal static class PdbDownloader + { + /// + /// The URL to the Microsoft Symbols Server, where the PDB files are hosted. + /// + internal const string MicrosoftSymbolsUrl = "https://msdl.microsoft.com/download/symbols"; + + /// + /// Tries to retrieve and download the PDB file for the given module. + /// + /// The name of the file. + /// The debug hash of the file. + internal static async Task TryDownloadPdbFile(string FileName, string Hash) + { + // + // Verify the passed parameters. + // + + if (string.IsNullOrEmpty(FileName)) + { + throw new ArgumentNullException(nameof(FileName), "The filename is null or empty."); + } + + if (string.IsNullOrEmpty(Hash)) + { + throw new ArgumentNullException(nameof(Hash), "The hash is null or empty."); + } + + // + // Format the parameters correctly. + // + + if (FileName.Contains(".")) + { + FileName = FileName.Split('.')[0]; + } + + if (Hash.Length == 32) + { + // + // The hash must contain the "age" of the file at the end. + // + + Hash += "1"; + } + + // + // Initialize the returned structure. + // + + var ReturnedResult = new PdbDownloadResult(); + + // + // Try to download the PDB file from the Microsoft Symbols Server. + // + + using (var HttpClient = new HttpClient()) + { + var HttpResponse = await HttpClient.GetAsync($"{MicrosoftSymbolsUrl}/{FileName}.pdb/{Hash}/{FileName}.pdb"); + + using (HttpResponse) + { + // + // Set the result to the returned structure. + // + + ReturnedResult.ResponseStatus = HttpResponse.StatusCode; + + if (HttpResponse.IsSuccessStatusCode) + { + ReturnedResult.ResponseBuffer = await HttpResponse.Content.ReadAsByteArrayAsync(); + } + } + } + + return ReturnedResult; + } + } +} diff --git a/PdbServer/Logic/Pe/PeFile.cs b/PdbServer/Logic/Pe/PeFile.cs new file mode 100644 index 0000000..08e1c12 --- /dev/null +++ b/PdbServer/Logic/Pe/PeFile.cs @@ -0,0 +1,7 @@ +namespace Microsoft.PdbDownloader.Logic.Pe +{ + internal class PeFile + { + + } +} diff --git a/PdbServer/Logic/Pe/PeUtils.cs b/PdbServer/Logic/Pe/PeUtils.cs new file mode 100644 index 0000000..5c10507 --- /dev/null +++ b/PdbServer/Logic/Pe/PeUtils.cs @@ -0,0 +1,99 @@ +namespace Microsoft.PdbDownloader.Logic.Pe +{ + using System; + using System.Diagnostics; + using System.Runtime.InteropServices; + + using Microsoft.PdbDownloader.Logic.Pe.Structures; + + internal static class PeUtils + { + internal static unsafe bool TryGetPdbMetadata(byte[] Buffer, out string PdbName, out string PdbHash) + { + PdbName = null; + PdbHash = null; + + // + // Build a pointer to the managed buffer. + // + + fixed (byte* FixedBuffer = Buffer) + { + var DosHeader = (IMAGE_DOS_HEADER*) FixedBuffer; + var NtHeaders = (IMAGE_NT_HEADERS64*) IntPtr.Add(new IntPtr(FixedBuffer), DosHeader->e_lfanew).ToPointer(); + + // + // Parse the debug directory. + // + + var DebugDirectory = &NtHeaders->OptionalHeader.Debug; + + Debug.WriteLine("[*] DebugDirectory.VirtualAddress: 0x" + DebugDirectory->VirtualAddress.ToString("X8")); + Debug.WriteLine("[*] DebugDirectory.Size: " + DebugDirectory->Size); + + if (DebugDirectory->VirtualAddress != 0) + { + var DebugEntries = (IMAGE_DEBUG_DIRECTORY*) VaToRva(Buffer, IntPtr.Add(new IntPtr(FixedBuffer), (int)DebugDirectory->VirtualAddress).ToPointer()); + var DebugEntriesSizeRead = 0; + var DebugEntriesIndex = 0; + + for (var DebugEntry = DebugEntries; + DebugEntriesSizeRead < DebugDirectory->Size; + DebugEntriesSizeRead += sizeof(IMAGE_DEBUG_DIRECTORY), DebugEntry++) + { + // + // Check if this is a CodeView debug entry. + // + + if (DebugEntry->Type == 2) + { + var DebugData = (IMAGE_DEBUG_DATA*) IntPtr.Add(new IntPtr(FixedBuffer), (int) DebugEntry->PointerToRawData); + + // + // Set the returned values. + // + + PdbName = Marshal.PtrToStringAnsi(new IntPtr(&DebugData->PdbFileName)); + PdbHash = $"{DebugData->Guid:N}{DebugData->Age}".ToUpper(); + break; + } + } + } + } + + return !string.IsNullOrEmpty(PdbName) && !string.IsNullOrEmpty(PdbHash); + } + + internal static unsafe void* VaToRva(byte[] Buffer, void* VirtualAddress) + { + // + // Build a pointer to the managed buffer. + // + + fixed (byte* FixedBuffer = Buffer) + { + var DosHeader = (IMAGE_DOS_HEADER*) FixedBuffer; + var NtHeaders = (IMAGE_NT_HEADERS64*) IntPtr.Add(new IntPtr(FixedBuffer), DosHeader->e_lfanew).ToPointer(); + + // + // Parse the sections. + // + + var CurrentSection = (IMAGE_SECTION_HEADER*) IntPtr.Add(new IntPtr(NtHeaders), sizeof(IMAGE_NT_HEADERS64)).ToPointer(); + + for (var I = 0; I < NtHeaders->FileHeader.NumberOfSections; I++, CurrentSection++) + { + var BeginSection = IntPtr.Add(new IntPtr(FixedBuffer), (int) CurrentSection->VirtualAddress).ToPointer(); + var EndSection = IntPtr.Add(new IntPtr(BeginSection), (int) CurrentSection->VirtualSize).ToPointer(); + + if (VirtualAddress >= BeginSection && VirtualAddress < EndSection) + { + return IntPtr.Add(IntPtr.Subtract(new IntPtr(VirtualAddress), (int) CurrentSection->VirtualAddress), (int) CurrentSection->PointerToRawData).ToPointer(); + } + } + } + + return null; + } + } +} diff --git a/PdbServer/Logic/Pe/Structures/PE.cs b/PdbServer/Logic/Pe/Structures/PE.cs new file mode 100644 index 0000000..5243951 --- /dev/null +++ b/PdbServer/Logic/Pe/Structures/PE.cs @@ -0,0 +1,561 @@ +namespace Microsoft.PdbDownloader.Logic.Pe.Structures +{ + using System; + using System.Runtime.InteropServices; + + [StructLayout(LayoutKind.Explicit, Pack = 1, Size = 0x40)] + public struct IMAGE_DOS_HEADER + { + [FieldOffset(0x00)] + public UInt16 e_magic; // Magic number + + [FieldOffset(0x3C)] + public Int32 e_lfanew; // File address of new exe header + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_NT_HEADERS64 + { + [FieldOffset(0)] + public int Signature; + + [FieldOffset(4)] + public IMAGE_FILE_HEADER FileHeader; + + [FieldOffset(24)] + public IMAGE_OPTIONAL_HEADER64 OptionalHeader; + } + + [StructLayout(LayoutKind.Sequential)] + public struct IMAGE_FILE_HEADER + { + public UInt16 Machine; + public UInt16 NumberOfSections; + public UInt32 TimeDateStamp; + public UInt32 PointerToSymbolTable; + public UInt32 NumberOfSymbols; + public UInt16 SizeOfOptionalHeader; + public UInt16 Characteristics; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_OPTIONAL_HEADER64 + { + [FieldOffset(0)] + public MagicType Magic; + + [FieldOffset(2)] + public byte MajorLinkerVersion; + + [FieldOffset(3)] + public byte MinorLinkerVersion; + + [FieldOffset(4)] + public uint SizeOfCode; + + [FieldOffset(8)] + public uint SizeOfInitializedData; + + [FieldOffset(12)] + public uint SizeOfUninitializedData; + + [FieldOffset(16)] + public uint AddressOfEntryPoint; + + [FieldOffset(20)] + public uint BaseOfCode; + + [FieldOffset(24)] + public ulong ImageBase; + + [FieldOffset(32)] + public uint SectionAlignment; + + [FieldOffset(36)] + public uint FileAlignment; + + [FieldOffset(40)] + public ushort MajorOperatingSystemVersion; + + [FieldOffset(42)] + public ushort MinorOperatingSystemVersion; + + [FieldOffset(44)] + public ushort MajorImageVersion; + + [FieldOffset(46)] + public ushort MinorImageVersion; + + [FieldOffset(48)] + public ushort MajorSubsystemVersion; + + [FieldOffset(50)] + public ushort MinorSubsystemVersion; + + [FieldOffset(52)] + public uint Win32VersionValue; + + [FieldOffset(56)] + public uint SizeOfImage; + + [FieldOffset(60)] + public uint SizeOfHeaders; + + [FieldOffset(64)] + public uint CheckSum; + + [FieldOffset(68)] + public SubSystemType Subsystem; + + [FieldOffset(70)] + public DllCharacteristicsType DllCharacteristics; + + [FieldOffset(72)] + public ulong SizeOfStackReserve; + + [FieldOffset(80)] + public ulong SizeOfStackCommit; + + [FieldOffset(88)] + public ulong SizeOfHeapReserve; + + [FieldOffset(96)] + public ulong SizeOfHeapCommit; + + [FieldOffset(104)] + public uint LoaderFlags; + + [FieldOffset(108)] + public uint NumberOfRvaAndSizes; + + [FieldOffset(112)] + public IMAGE_DATA_DIRECTORY ExportTable; + + [FieldOffset(120)] + public IMAGE_DATA_DIRECTORY ImportTable; + + [FieldOffset(128)] + public IMAGE_DATA_DIRECTORY ResourceTable; + + [FieldOffset(136)] + public IMAGE_DATA_DIRECTORY ExceptionTable; + + [FieldOffset(144)] + public IMAGE_DATA_DIRECTORY CertificateTable; + + [FieldOffset(152)] + public IMAGE_DATA_DIRECTORY BaseRelocationTable; + + [FieldOffset(160)] + public IMAGE_DATA_DIRECTORY Debug; + + [FieldOffset(168)] + public IMAGE_DATA_DIRECTORY Architecture; + + [FieldOffset(176)] + public IMAGE_DATA_DIRECTORY GlobalPtr; + + [FieldOffset(184)] + public IMAGE_DATA_DIRECTORY TLSTable; + + [FieldOffset(192)] + public IMAGE_DATA_DIRECTORY LoadConfigTable; + + [FieldOffset(200)] + public IMAGE_DATA_DIRECTORY BoundImport; + + [FieldOffset(208)] + public IMAGE_DATA_DIRECTORY IAT; + + [FieldOffset(216)] + public IMAGE_DATA_DIRECTORY DelayImportDescriptor; + + [FieldOffset(224)] + public IMAGE_DATA_DIRECTORY CLRRuntimeHeader; + + [FieldOffset(232)] + public IMAGE_DATA_DIRECTORY Reserved; + } + + [StructLayout(LayoutKind.Sequential)] + public struct IMAGE_DATA_DIRECTORY + { + public UInt32 VirtualAddress; + public UInt32 Size; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_SECTION_HEADER + { + [FieldOffset(0)] + public ulong Name; + + [FieldOffset(8)] + public UInt32 VirtualSize; + + [FieldOffset(12)] + public UInt32 VirtualAddress; + + [FieldOffset(16)] + public UInt32 SizeOfRawData; + + [FieldOffset(20)] + public UInt32 PointerToRawData; + + [FieldOffset(24)] + public UInt32 PointerToRelocations; + + [FieldOffset(28)] + public UInt32 PointerToLinenumbers; + + [FieldOffset(32)] + public UInt16 NumberOfRelocations; + + [FieldOffset(34)] + public UInt16 NumberOfLinenumbers; + + [FieldOffset(36)] + public DataSectionFlags Characteristics; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_BASE_RELOCATION + { + [FieldOffset(0)] + public uint VirtualAddress; + + [FieldOffset(4)] + public uint SizeOfBlock; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_DEBUG_DIRECTORY + { + [FieldOffset(0)] + public uint Characteristics; + + [FieldOffset(4)] + public uint TimeDateStamp; + + [FieldOffset(8)] + public ushort MajorVersion; + + [FieldOffset(10)] + public ushort MinorVersion; + + [FieldOffset(12)] + public uint Type; + + [FieldOffset(16)] + public uint SizeOfData; + + [FieldOffset(20)] + public uint AddressOfRawData; + + [FieldOffset(24)] + public uint PointerToRawData; + } + + [StructLayout(LayoutKind.Explicit)] + public unsafe struct IMAGE_DEBUG_DATA + { + [FieldOffset(0x00)] + public char Signature; + + [FieldOffset(0x01)] + private char _Signature2; + [FieldOffset(0x02)] + private char _Signature3; + [FieldOffset(0x03)] + private char _Signature4; + + [FieldOffset(0x04)] + public Guid Guid; + + [FieldOffset(0x14)] + public int Age; + + [FieldOffset(0x18)] + public char PdbFileName; + } + + [Flags] + public enum DataSectionFlags : uint + { + /// + /// Reserved for future use. + /// + TypeReg = 0x00000000, + /// + /// Reserved for future use. + /// + TypeDsect = 0x00000001, + /// + /// Reserved for future use. + /// + TypeNoLoad = 0x00000002, + /// + /// Reserved for future use. + /// + TypeGroup = 0x00000004, + /// + /// The section should not be padded to the next boundary. This flag is obsolete and is replaced by IMAGE_SCN_ALIGN_1BYTES. This is valid only for object files. + /// + TypeNoPadded = 0x00000008, + /// + /// Reserved for future use. + /// + TypeCopy = 0x00000010, + /// + /// The section contains executable code. + /// + ContentCode = 0x00000020, + /// + /// The section contains initialized data. + /// + ContentInitializedData = 0x00000040, + /// + /// The section contains uninitialized data. + /// + ContentUninitializedData = 0x00000080, + /// + /// Reserved for future use. + /// + LinkOther = 0x00000100, + /// + /// The section contains comments or other information. The .drectve section has this type. This is valid for object files only. + /// + LinkInfo = 0x00000200, + /// + /// Reserved for future use. + /// + TypeOver = 0x00000400, + /// + /// The section will not become part of the image. This is valid only for object files. + /// + LinkRemove = 0x00000800, + /// + /// The section contains COMDAT data. For more information, see section 5.5.6, COMDAT Sections (Object Only). This is valid only for object files. + /// + LinkComDat = 0x00001000, + /// + /// Reset speculative exceptions handling bits in the TLB entries for this section. + /// + NoDeferSpecExceptions = 0x00004000, + /// + /// The section contains data referenced through the global pointer (GP). + /// + RelativeGP = 0x00008000, + /// + /// Reserved for future use. + /// + MemPurgeable = 0x00020000, + /// + /// Reserved for future use. + /// + Memory16Bit = 0x00020000, + /// + /// Reserved for future use. + /// + MemoryLocked = 0x00040000, + /// + /// Reserved for future use. + /// + MemoryPreload = 0x00080000, + /// + /// Align data on a 1-byte boundary. Valid only for object files. + /// + Align1Bytes = 0x00100000, + /// + /// Align data on a 2-byte boundary. Valid only for object files. + /// + Align2Bytes = 0x00200000, + /// + /// Align data on a 4-byte boundary. Valid only for object files. + /// + Align4Bytes = 0x00300000, + /// + /// Align data on an 8-byte boundary. Valid only for object files. + /// + Align8Bytes = 0x00400000, + /// + /// Align data on a 16-byte boundary. Valid only for object files. + /// + Align16Bytes = 0x00500000, + /// + /// Align data on a 32-byte boundary. Valid only for object files. + /// + Align32Bytes = 0x00600000, + /// + /// Align data on a 64-byte boundary. Valid only for object files. + /// + Align64Bytes = 0x00700000, + /// + /// Align data on a 128-byte boundary. Valid only for object files. + /// + Align128Bytes = 0x00800000, + /// + /// Align data on a 256-byte boundary. Valid only for object files. + /// + Align256Bytes = 0x00900000, + /// + /// Align data on a 512-byte boundary. Valid only for object files. + /// + Align512Bytes = 0x00A00000, + /// + /// Align data on a 1024-byte boundary. Valid only for object files. + /// + Align1024Bytes = 0x00B00000, + /// + /// Align data on a 2048-byte boundary. Valid only for object files. + /// + Align2048Bytes = 0x00C00000, + /// + /// Align data on a 4096-byte boundary. Valid only for object files. + /// + Align4096Bytes = 0x00D00000, + /// + /// Align data on an 8192-byte boundary. Valid only for object files. + /// + Align8192Bytes = 0x00E00000, + /// + /// The section contains extended relocations. + /// + LinkExtendedRelocationOverflow = 0x01000000, + /// + /// The section can be discarded as needed. + /// + MemoryDiscardable = 0x02000000, + /// + /// The section cannot be cached. + /// + MemoryNotCached = 0x04000000, + /// + /// The section is not pageable. + /// + MemoryNotPaged = 0x08000000, + /// + /// The section can be shared in memory. + /// + MemoryShared = 0x10000000, + /// + /// The section can be executed as code. + /// + MemoryExecute = 0x20000000, + /// + /// The section can be read. + /// + MemoryRead = 0x40000000, + /// + /// The section can be written to. + /// + MemoryWrite = 0x80000000 + } + + public enum MachineType : ushort + { + Native = 0, + I386 = 0x014c, + Itanium = 0x0200, + x64 = 0x8664 + } + public enum MagicType : ushort + { + IMAGE_NT_OPTIONAL_HDR32_MAGIC = 0x10b, + IMAGE_NT_OPTIONAL_HDR64_MAGIC = 0x20b + } + public enum SubSystemType : ushort + { + IMAGE_SUBSYSTEM_UNKNOWN = 0, + IMAGE_SUBSYSTEM_NATIVE = 1, + IMAGE_SUBSYSTEM_WINDOWS_GUI = 2, + IMAGE_SUBSYSTEM_WINDOWS_CUI = 3, + IMAGE_SUBSYSTEM_POSIX_CUI = 7, + IMAGE_SUBSYSTEM_WINDOWS_CE_GUI = 9, + IMAGE_SUBSYSTEM_EFI_APPLICATION = 10, + IMAGE_SUBSYSTEM_EFI_BOOT_SERVICE_DRIVER = 11, + IMAGE_SUBSYSTEM_EFI_RUNTIME_DRIVER = 12, + IMAGE_SUBSYSTEM_EFI_ROM = 13, + IMAGE_SUBSYSTEM_XBOX = 14 + + } + public enum DllCharacteristicsType : ushort + { + RES_0 = 0x0001, + RES_1 = 0x0002, + RES_2 = 0x0004, + RES_3 = 0x0008, + IMAGE_DLL_CHARACTERISTICS_DYNAMIC_BASE = 0x0040, + IMAGE_DLL_CHARACTERISTICS_FORCE_INTEGRITY = 0x0080, + IMAGE_DLL_CHARACTERISTICS_NX_COMPAT = 0x0100, + IMAGE_DLLCHARACTERISTICS_NO_ISOLATION = 0x0200, + IMAGE_DLLCHARACTERISTICS_NO_SEH = 0x0400, + IMAGE_DLLCHARACTERISTICS_NO_BIND = 0x0800, + RES_4 = 0x1000, + IMAGE_DLLCHARACTERISTICS_WDM_DRIVER = 0x2000, + IMAGE_DLLCHARACTERISTICS_TERMINAL_SERVER_AWARE = 0x8000 + } + + public static class RelocationType + { + public const short IMAGE_REL_BASED_ABSOLUTE = 0; + public const short IMAGE_REL_BASED_HIGH = 1; + public const short IMAGE_REL_BASED_LOW = 2; + public const short IMAGE_REL_BASED_HIGHLOW = 3; + public const short IMAGE_REL_BASED_HIGHADJ = 4; + public const short IMAGE_REL_BASED_MACHINE_SPECIFIC_5 = 5; + public const short IMAGE_REL_BASED_RESERVED = 6; + public const short IMAGE_REL_BASED_MACHINE_SPECIFIC_7 = 7; + public const short IMAGE_REL_BASED_MACHINE_SPECIFIC_8 = 8; + public const short IMAGE_REL_BASED_MACHINE_SPECIFIC_9 = 9; + public const short IMAGE_REL_BASED_DIR64 = 10; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_IMPORT_DESCRIPTOR + { + [FieldOffset(0x00)] + public int Characteristics; + + [FieldOffset(0x00)] + public int OriginalFirstThunk; + + [FieldOffset(0x04)] + public int TimeDateStamp; + + [FieldOffset(0x08)] + public int ForwarderChain; + + [FieldOffset(0x0C)] + public int Name; + + [FieldOffset(0x10)] + public int FirstThunk; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_IMPORT_BY_NAME + { + [FieldOffset(0x00)] + public short Hint; + + [FieldOffset(0x02)] + public char Name; + } + + [StructLayout(LayoutKind.Explicit)] + public struct IMAGE_THUNK_DATA64 + { + [FieldOffset(0x00)] + public ulong ForwarderString; + + [FieldOffset(0x00)] + public ulong Function; + + [FieldOffset(0x00)] + public ulong Ordinal; + + [FieldOffset(0x00)] + public ulong AddressOfData; + } +} diff --git a/PdbServer/Logic/Pe/Structures/SYSTEM_MODULE_ENTRY.cs b/PdbServer/Logic/Pe/Structures/SYSTEM_MODULE_ENTRY.cs new file mode 100644 index 0000000..bdbe03e --- /dev/null +++ b/PdbServer/Logic/Pe/Structures/SYSTEM_MODULE_ENTRY.cs @@ -0,0 +1,20 @@ +namespace Microsoft.PdbDownloader.Logic.Pe.Structures +{ + using System; + using System.Runtime.InteropServices; + + [StructLayout(LayoutKind.Sequential, Pack = 1, Size = 296)] + public struct SYSTEM_MODULE_ENTRY + { + public UIntPtr Section; + public UIntPtr MappedBase; + public UIntPtr ImageBase; + public int ImageSize; + public uint Flags; + public ushort LoadOrderIndex; + public ushort InitOrderIndex; + public ushort LoadCount; + public ushort OffsetToFileName; + public char FullPathName; + } +} diff --git a/PdbServer/Logic/Pe/Structures/SYSTEM_MODULE_INFORMATION.cs b/PdbServer/Logic/Pe/Structures/SYSTEM_MODULE_INFORMATION.cs new file mode 100644 index 0000000..2ee1b41 --- /dev/null +++ b/PdbServer/Logic/Pe/Structures/SYSTEM_MODULE_INFORMATION.cs @@ -0,0 +1,10 @@ +namespace Microsoft.PdbDownloader.Logic.Pe.Structures +{ + using System.Runtime.InteropServices; + + [StructLayout(LayoutKind.Sequential, Size = 8)] + public struct SYSTEM_MODULE_INFORMATION + { + public uint NumberOfModules; + } +} diff --git a/PdbServer/PdbPaeser/BasicType.cs b/PdbServer/PdbPaeser/BasicType.cs new file mode 100644 index 0000000..df14e30 --- /dev/null +++ b/PdbServer/PdbPaeser/BasicType.cs @@ -0,0 +1,45 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000012 RID: 18 + public enum BasicType + { + // Token: 0x0400005A RID: 90 + NoType, + // Token: 0x0400005B RID: 91 + Void, + // Token: 0x0400005C RID: 92 + Char, + // Token: 0x0400005D RID: 93 + WChar, + // Token: 0x0400005E RID: 94 + Int = 6, + // Token: 0x0400005F RID: 95 + UInt, + // Token: 0x04000060 RID: 96 + Float, + // Token: 0x04000061 RID: 97 + BCD, + // Token: 0x04000062 RID: 98 + Bool, + // Token: 0x04000063 RID: 99 + Long = 13, + // Token: 0x04000064 RID: 100 + ULong, + // Token: 0x04000065 RID: 101 + Currency = 25, + // Token: 0x04000066 RID: 102 + Date, + // Token: 0x04000067 RID: 103 + Variant, + // Token: 0x04000068 RID: 104 + Complex, + // Token: 0x04000069 RID: 105 + Bit, + // Token: 0x0400006A RID: 106 + BSTR, + // Token: 0x0400006B RID: 107 + Hresult + } +} diff --git a/PdbServer/PdbPaeser/EnumSourceFilesCallback.cs b/PdbServer/PdbPaeser/EnumSourceFilesCallback.cs new file mode 100644 index 0000000..41d6a5d --- /dev/null +++ b/PdbServer/PdbPaeser/EnumSourceFilesCallback.cs @@ -0,0 +1,8 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000010 RID: 16 + // (Invoke) Token: 0x0600004D RID: 77 + internal delegate bool EnumSourceFilesCallback(SOURCEFILE sourceFile, IntPtr context); +} diff --git a/PdbServer/PdbPaeser/Extensions.cs b/PdbServer/PdbPaeser/Extensions.cs new file mode 100644 index 0000000..06e5475 --- /dev/null +++ b/PdbServer/PdbPaeser/Extensions.cs @@ -0,0 +1,20 @@ +using System; +using System.ComponentModel; +using System.Runtime.InteropServices; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000004 RID: 4 + internal static class Extensions + { + // Token: 0x06000003 RID: 3 RVA: 0x00002058 File Offset: 0x00000258 + public static bool ThrowIfWin32Failed(this bool ok, int error = 0) + { + if (!ok) + { + throw new Win32Exception((error != 0) ? error : Marshal.GetLastWin32Error()); + } + return true; + } + } +} diff --git a/PdbServer/PdbPaeser/FindChildrenParams.cs b/PdbServer/PdbPaeser/FindChildrenParams.cs new file mode 100644 index 0000000..aace974 --- /dev/null +++ b/PdbServer/PdbPaeser/FindChildrenParams.cs @@ -0,0 +1,19 @@ +using System; +using System.Runtime.InteropServices; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000016 RID: 22 + internal struct FindChildrenParams + { + // Token: 0x040000C0 RID: 192 + public int Count; + + // Token: 0x040000C1 RID: 193 + public int Start; + + // Token: 0x040000C2 RID: 194 + [MarshalAs(UnmanagedType.ByValArray, SizeConst = 400)] + public int[] Child; + } +} diff --git a/PdbServer/PdbPaeser/Microsoft/CodeAnalysis/EmbeddedAttribute.cs b/PdbServer/PdbPaeser/Microsoft/CodeAnalysis/EmbeddedAttribute.cs new file mode 100644 index 0000000..5f28270 --- /dev/null +++ b/PdbServer/PdbPaeser/Microsoft/CodeAnalysis/EmbeddedAttribute.cs @@ -0,0 +1 @@ + \ No newline at end of file diff --git a/PdbServer/PdbPaeser/ModuleInfo.cs b/PdbServer/PdbPaeser/ModuleInfo.cs new file mode 100644 index 0000000..6abbf33 --- /dev/null +++ b/PdbServer/PdbPaeser/ModuleInfo.cs @@ -0,0 +1,18 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000005 RID: 5 + public sealed class ModuleInfo + { + // Token: 0x17000001 RID: 1 + // (get) Token: 0x06000004 RID: 4 RVA: 0x0000206F File Offset: 0x0000026F + // (set) Token: 0x06000005 RID: 5 RVA: 0x00002077 File Offset: 0x00000277 + public string Name { get; set; } + + // Token: 0x17000002 RID: 2 + // (get) Token: 0x06000006 RID: 6 RVA: 0x00002080 File Offset: 0x00000280 + // (set) Token: 0x06000007 RID: 7 RVA: 0x00002088 File Offset: 0x00000288 + public ulong Base { get; set; } + } +} diff --git a/PdbServer/PdbPaeser/ProcessAccessMask.cs b/PdbServer/PdbPaeser/ProcessAccessMask.cs new file mode 100644 index 0000000..92c7b21 --- /dev/null +++ b/PdbServer/PdbPaeser/ProcessAccessMask.cs @@ -0,0 +1,11 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x0200000E RID: 14 + internal enum ProcessAccessMask : uint + { + // Token: 0x04000056 RID: 86 + Query = 1024U + } +} diff --git a/PdbServer/PdbPaeser/SOURCEFILE.2.cs b/PdbServer/PdbPaeser/SOURCEFILE.2.cs new file mode 100644 index 0000000..0d2c217 --- /dev/null +++ b/PdbServer/PdbPaeser/SOURCEFILE.2.cs @@ -0,0 +1,16 @@ +using System; +using System.Runtime.InteropServices; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000011 RID: 17 + [StructLayout(LayoutKind.Sequential, CharSet = CharSet.Unicode)] + public struct SOURCEFILE + { + // Token: 0x04000057 RID: 87 + public ulong ModuleBase; + + // Token: 0x04000058 RID: 88 + public unsafe char* FileName; + } +} diff --git a/PdbServer/PdbPaeser/SourceFile.cs b/PdbServer/PdbPaeser/SourceFile.cs new file mode 100644 index 0000000..65348ea --- /dev/null +++ b/PdbServer/PdbPaeser/SourceFile.cs @@ -0,0 +1,18 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000006 RID: 6 + public class SourceFile + { + // Token: 0x17000003 RID: 3 + // (get) Token: 0x06000009 RID: 9 RVA: 0x00002099 File Offset: 0x00000299 + // (set) Token: 0x0600000A RID: 10 RVA: 0x000020A1 File Offset: 0x000002A1 + public ulong BaseAddress { get; set; } + + // Token: 0x17000004 RID: 4 + // (get) Token: 0x0600000B RID: 11 RVA: 0x000020AA File Offset: 0x000002AA + // (set) Token: 0x0600000C RID: 12 RVA: 0x000020B2 File Offset: 0x000002B2 + public string FileName { get; set; } + } +} diff --git a/PdbServer/PdbPaeser/SourceFileLine.cs b/PdbServer/PdbPaeser/SourceFileLine.cs new file mode 100644 index 0000000..e3516aa --- /dev/null +++ b/PdbServer/PdbPaeser/SourceFileLine.cs @@ -0,0 +1,23 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000007 RID: 7 + public class SourceFileLine + { + // Token: 0x17000005 RID: 5 + // (get) Token: 0x0600000E RID: 14 RVA: 0x000020BB File Offset: 0x000002BB + public SourceFile SourceFile { get; } + + // Token: 0x17000006 RID: 6 + // (get) Token: 0x0600000F RID: 15 RVA: 0x000020C3 File Offset: 0x000002C3 + public string Line { get; } + + // Token: 0x06000010 RID: 16 RVA: 0x000020CB File Offset: 0x000002CB + public SourceFileLine(SourceFile file, string line) + { + this.SourceFile = file; + this.Line = line; + } + } +} diff --git a/PdbServer/PdbPaeser/StructDescriptor.cs b/PdbServer/PdbPaeser/StructDescriptor.cs new file mode 100644 index 0000000..720f562 --- /dev/null +++ b/PdbServer/PdbPaeser/StructDescriptor.cs @@ -0,0 +1,89 @@ +using System; +using System.Collections; +using System.Collections.Generic; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000009 RID: 9 + public sealed class StructDescriptor : IReadOnlyList, IReadOnlyCollection, IEnumerable, IEnumerable + { + // Token: 0x06000019 RID: 25 RVA: 0x000021BA File Offset: 0x000003BA + internal StructDescriptor(int capacity = 8) + { + this._membersByName = new Dictionary(capacity, StringComparer.InvariantCultureIgnoreCase); + this._members = new List(capacity); + } + + // Token: 0x0600001A RID: 26 RVA: 0x000021E0 File Offset: 0x000003E0 + public int GetOffsetOf(string memberName) + { + StructMember structMember; + if (!this._membersByName.TryGetValue(memberName, out structMember)) + { + return -1; + } + return structMember.Offset; + } + + // Token: 0x0600001B RID: 27 RVA: 0x00002208 File Offset: 0x00000408 + public StructMember GetMember(string memberName) + { + StructMember result; + if (!this._membersByName.TryGetValue(memberName, out result)) + { + return null; + } + return result; + } + + // Token: 0x1700000B RID: 11 + // (get) Token: 0x0600001C RID: 28 RVA: 0x00002228 File Offset: 0x00000428 + // (set) Token: 0x0600001D RID: 29 RVA: 0x00002230 File Offset: 0x00000430 + public int Length { get; internal set; } + + // Token: 0x1700000C RID: 12 + // (get) Token: 0x0600001E RID: 30 RVA: 0x00002239 File Offset: 0x00000439 + public int Count + { + get + { + return this._members.Count; + } + } + + // Token: 0x1700000D RID: 13 + public StructMember this[int index] + { + get + { + return this._members[index]; + } + } + + // Token: 0x06000020 RID: 32 RVA: 0x00002254 File Offset: 0x00000454 + public void AddMember(StructMember member) + { + member.Parent = this; + this._membersByName.Add(member.Symbol.Name, member); + this._members.Add(member); + } + + // Token: 0x06000021 RID: 33 RVA: 0x00002280 File Offset: 0x00000480 + public IEnumerator GetEnumerator() + { + return this._members.GetEnumerator(); + } + + // Token: 0x06000022 RID: 34 RVA: 0x00002292 File Offset: 0x00000492 + IEnumerator IEnumerable.GetEnumerator() + { + return this.GetEnumerator(); + } + + // Token: 0x0400000B RID: 11 + private readonly Dictionary _membersByName; + + // Token: 0x0400000C RID: 12 + private readonly List _members; + } +} diff --git a/PdbServer/PdbPaeser/StructMember.cs b/PdbServer/PdbPaeser/StructMember.cs new file mode 100644 index 0000000..9175dd4 --- /dev/null +++ b/PdbServer/PdbPaeser/StructMember.cs @@ -0,0 +1,82 @@ +using System; +using System.Diagnostics; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000008 RID: 8 + [DebuggerDisplay("{Name,nq} offset={Offset,d} size={Size,d}")] + public sealed class StructMember + { + // Token: 0x17000007 RID: 7 + // (get) Token: 0x06000011 RID: 17 RVA: 0x000020E1 File Offset: 0x000002E1 + // (set) Token: 0x06000012 RID: 18 RVA: 0x000020E9 File Offset: 0x000002E9 + public StructDescriptor Parent { get; internal set; } + + // Token: 0x17000008 RID: 8 + // (get) Token: 0x06000013 RID: 19 RVA: 0x000020F2 File Offset: 0x000002F2 + public string Name + { + get + { + return this.Symbol.Name; + } + } + + // Token: 0x17000009 RID: 9 + // (get) Token: 0x06000014 RID: 20 RVA: 0x000020FF File Offset: 0x000002FF + public int Size + { + get + { + return this.Symbol.Size; + } + } + + // Token: 0x06000015 RID: 21 RVA: 0x0000210C File Offset: 0x0000030C + public StructMember(ref SymbolInfo symbol, int offset) + { + this.Symbol = symbol; + this.Offset = offset; + } + + // Token: 0x06000016 RID: 22 RVA: 0x00002127 File Offset: 0x00000327 + public StructMember Clone() + { + StructMember structMember = (StructMember)base.MemberwiseClone(); + structMember.Parent = null; + return structMember; + } + + // Token: 0x1700000A RID: 10 + // (get) Token: 0x06000017 RID: 23 RVA: 0x0000213B File Offset: 0x0000033B + public int TypeId + { + get + { + return this.Symbol.TypeIndex; + } + } + + // Token: 0x06000018 RID: 24 RVA: 0x00002148 File Offset: 0x00000348 + public override string ToString() + { + return string.Format("{0}, size={1}, offset={2}, typeid={3} tag={4}", new object[] + { + this.Symbol.Name, + this.Symbol.Size, + this.Offset, + this.Symbol.TypeIndex, + this.Symbol.Tag + }); + } + + // Token: 0x04000007 RID: 7 + public readonly int Offset; + + // Token: 0x04000009 RID: 9 + public readonly SymbolInfo Symbol; + + // Token: 0x0400000A RID: 10 + public long Value; + } +} diff --git a/PdbServer/PdbPaeser/SymEnumerateModuleProc.cs b/PdbServer/PdbPaeser/SymEnumerateModuleProc.cs new file mode 100644 index 0000000..984bc54 --- /dev/null +++ b/PdbServer/PdbPaeser/SymEnumerateModuleProc.cs @@ -0,0 +1,8 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x0200000F RID: 15 + // (Invoke) Token: 0x06000049 RID: 73 + internal delegate bool SymEnumerateModuleProc(string module, ulong dllBase, IntPtr context); +} diff --git a/PdbServer/PdbPaeser/SymbolFlags.cs b/PdbServer/PdbPaeser/SymbolFlags.cs new file mode 100644 index 0000000..c1ac5a1 --- /dev/null +++ b/PdbServer/PdbPaeser/SymbolFlags.cs @@ -0,0 +1,54 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x0200000B RID: 11 + [Flags] + public enum SymbolFlags : uint + { + // Token: 0x04000012 RID: 18 + None = 0U, + // Token: 0x04000013 RID: 19 + ClrToken = 262144U, + // Token: 0x04000014 RID: 20 + Constant = 256U, + // Token: 0x04000015 RID: 21 + Export = 512U, + // Token: 0x04000016 RID: 22 + Forwarder = 1024U, + // Token: 0x04000017 RID: 23 + FrameRelative = 32U, + // Token: 0x04000018 RID: 24 + Function = 2048U, + // Token: 0x04000019 RID: 25 + ILRelative = 65536U, + // Token: 0x0400001A RID: 26 + Local = 128U, + // Token: 0x0400001B RID: 27 + Metadata = 131072U, + // Token: 0x0400001C RID: 28 + Parameter = 64U, + // Token: 0x0400001D RID: 29 + Register = 8U, + // Token: 0x0400001E RID: 30 + RegisterRelative = 16U, + // Token: 0x0400001F RID: 31 + Slot = 32768U, + // Token: 0x04000020 RID: 32 + Thunk = 8192U, + // Token: 0x04000021 RID: 33 + TLSRelative = 16384U, + // Token: 0x04000022 RID: 34 + ValuePresent = 1U, + // Token: 0x04000023 RID: 35 + Virtual = 4096U, + // Token: 0x04000024 RID: 36 + Null = 524288U, + // Token: 0x04000025 RID: 37 + FunctionNoReturn = 1048576U, + // Token: 0x04000026 RID: 38 + SyntheticZeroBase = 2097152U, + // Token: 0x04000027 RID: 39 + PublicCode = 4194304U + } +} diff --git a/PdbServer/PdbPaeser/SymbolHandler.cs b/PdbServer/PdbPaeser/SymbolHandler.cs new file mode 100644 index 0000000..94dac4b --- /dev/null +++ b/PdbServer/PdbPaeser/SymbolHandler.cs @@ -0,0 +1,438 @@ +using System; +using System.Collections.Generic; +using System.ComponentModel; +using System.Diagnostics; +using System.Runtime.InteropServices; +using System.Threading.Tasks; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x0200000A RID: 10 + public sealed class SymbolHandler : IDisposable + { + // Token: 0x06000023 RID: 35 RVA: 0x0000229A File Offset: 0x0000049A + private SymbolHandler(IntPtr hProcess, bool ownHandle) + { + this._hProcess = hProcess; + this._ownHandle = ownHandle; + } + + // Token: 0x06000024 RID: 36 RVA: 0x000022B0 File Offset: 0x000004B0 + public static SymbolHandler CreateFromProcess(int pid, SymbolOptions options = SymbolOptions.None, string searchPath = null) + { + if (searchPath == null) + { + searchPath = SymbolHandler.GetDefaultSearchPath(); + } + IntPtr hProcess = new IntPtr(pid); + if (Win32.SymInitialize(hProcess, searchPath, true)) + { + return new SymbolHandler(hProcess, false); + } + throw new Win32Exception(Marshal.GetLastWin32Error()); + } + + // Token: 0x06000025 RID: 37 RVA: 0x000022EC File Offset: 0x000004EC + public static SymbolHandler TryCreateFromProcess(int pid, SymbolOptions options = SymbolOptions.None, string searchPath = null) + { + if (searchPath == null) + { + searchPath = SymbolHandler.GetDefaultSearchPath(); + } + IntPtr hProcess = new IntPtr(pid); + if (Win32.SymInitialize(hProcess, searchPath, true)) + { + return new SymbolHandler(hProcess, false); + } + return null; + } + + // Token: 0x06000026 RID: 38 RVA: 0x0000231E File Offset: 0x0000051E + public static SymbolHandler CreateFromHandle(IntPtr handle, SymbolOptions options = SymbolOptions.None, string searchPath = null) + { + if (searchPath == null) + { + searchPath = SymbolHandler.GetDefaultSearchPath(); + } + Win32.SymSetOptions(options); + Win32.SymInitialize(handle, searchPath, true).ThrowIfWin32Failed(0); + return new SymbolHandler(handle, false); + } + + // Token: 0x06000027 RID: 39 RVA: 0x00002348 File Offset: 0x00000548 + private static string GetDefaultSearchPath() + { + string text = Environment.GetEnvironmentVariable("_NT_SYMBOL_PATH"); + if (text != null) + { + int num = text.IndexOf('*'); + if (num < 0) + { + return text; + } + text = text.Substring(num + 1, text.IndexOf('*', num + 1) - num - 1); + if (string.IsNullOrWhiteSpace(text)) + { + text = Environment.GetFolderPath(Environment.SpecialFolder.UserProfile); + } + } + return text; + } + + // Token: 0x06000028 RID: 40 RVA: 0x0000239C File Offset: 0x0000059C + public static SymbolHandler Create(SymbolOptions options = SymbolOptions.CaseInsensitive | SymbolOptions.UndecorateNames, string searchPath = null) + { + if (Debugger.IsAttached) + { + options |= (SymbolOptions)2147483648U; + } + if (searchPath == null) + { + searchPath = SymbolHandler.GetDefaultSearchPath(); + } + Win32.SymSetOptions(options); + IntPtr hProcess = new IntPtr(++SymbolHandler._instances); + Win32.SymInitialize(hProcess, searchPath, false).ThrowIfWin32Failed(0); + return new SymbolHandler(hProcess, false); + } + + // Token: 0x06000029 RID: 41 RVA: 0x000023F1 File Offset: 0x000005F1 + public void Dispose() + { + Win32.SymCleanup(this._hProcess); + if (this._ownHandle) + { + Win32.CloseHandle(this._hProcess); + } + } + + // Token: 0x0600002A RID: 42 RVA: 0x00002414 File Offset: 0x00000614 + public ulong LoadSymbolsForModule(string imageName, ulong dllBase = 0UL, string moduleName = null, IntPtr? hFile = null) + { + ulong num = Win32.SymLoadModuleEx(this._hProcess, hFile ?? IntPtr.Zero, imageName, moduleName, dllBase, 0U, IntPtr.Zero, 0U); + int lastWin32Error = Marshal.GetLastWin32Error(); + if (num == 0UL && lastWin32Error != 0) + { + throw new Win32Exception(lastWin32Error); + } + return num; + } + + // Token: 0x0600002B RID: 43 RVA: 0x00002464 File Offset: 0x00000664 + public ulong TryLoadSymbolsForModule(string imageName, string moduleName = null, IntPtr? hFile = null) + { + return Win32.SymLoadModuleEx(this._hProcess, hFile ?? IntPtr.Zero, imageName, moduleName, 0UL, 0U, IntPtr.Zero, 0U); + } + + // Token: 0x0600002C RID: 44 RVA: 0x000024A0 File Offset: 0x000006A0 + public Task TryLoadSymbolsForModuleAsync(string imageName, ulong dllBase = 0UL, string moduleName = null, IntPtr? hFile = null) + { + return Task.Run(() => Win32.SymLoadModuleEx(this._hProcess, hFile ?? IntPtr.Zero, imageName, moduleName, dllBase, 0U, IntPtr.Zero, 0U)); + } + + // Token: 0x0600002D RID: 45 RVA: 0x000024DC File Offset: 0x000006DC + public SymbolInfo GetSymbolFromAddress(ulong address, out ulong displacement) + { + SymbolInfo result = default(SymbolInfo); + result.Init(); + Win32.SymFromAddr(this._hProcess, address, out displacement, ref result).ThrowIfWin32Failed(0); + return result; + } + + // Token: 0x0600002E RID: 46 RVA: 0x0000250F File Offset: 0x0000070F + public bool TryGetSymbolFromAddress(ulong address, ref SymbolInfo symbol, out ulong displacement) + { + symbol.Init(); + return Win32.SymFromAddr(this._hProcess, address, out displacement, ref symbol); + } + + // Token: 0x0600002F RID: 47 RVA: 0x00002528 File Offset: 0x00000728 + public IReadOnlyList EnumModules() + { + List modules = new List(8); + Win32.SymEnumerateModules64(this._hProcess, delegate(string name, ulong dllBase, IntPtr context) + { + modules.Add(new ModuleInfo + { + Name = name, + Base = dllBase + }); + return true; + }, IntPtr.Zero).ThrowIfWin32Failed(0); + return modules; + } + + // Token: 0x06000030 RID: 48 RVA: 0x00002570 File Offset: 0x00000770 + public bool GetSymbolFromName(string name, ref SymbolInfo symbol) + { + return Win32.SymFromName(this._hProcess, name, ref symbol); + } + + // Token: 0x06000031 RID: 49 RVA: 0x0000257F File Offset: 0x0000077F + public bool GetSymbolFromIndex(ulong dllBase, int index, ref SymbolInfo symbol) + { + return Win32.SymFromIndex(this._hProcess, dllBase, index, ref symbol); + } + + // Token: 0x06000032 RID: 50 RVA: 0x00002590 File Offset: 0x00000790 + public ICollection EnumSymbols(ulong baseAddress, string mask = "*!*") + { + List symbols = new List(16); + Win32.SymEnumSymbols(this._hProcess, baseAddress, mask, delegate(ref SymbolInfo symbol, uint size, IntPtr context) + { + symbols.Add(symbol); + return true; + }, IntPtr.Zero); + return symbols; + } + + // Token: 0x06000033 RID: 51 RVA: 0x000025D8 File Offset: 0x000007D8 + public IList EnumTypes(ulong baseAddress, string mask = "*") + { + List symbols = new List(16); + Win32.SymEnumTypesByName(this._hProcess, baseAddress, mask, delegate(ref SymbolInfo symbol, uint size, IntPtr context) + { + symbols.Add(symbol); + return true; + }, IntPtr.Zero); + return symbols; + } + + // Token: 0x06000034 RID: 52 RVA: 0x00002620 File Offset: 0x00000820 + public unsafe IList EnumSourceFiles(ulong baseAddress, string mask = "*") + { + List files = new List(4); + Win32.SymEnumSourceFiles(this._hProcess, baseAddress, mask, delegate(SOURCEFILE source, IntPtr context) + { + files.Add(new SourceFile + { + BaseAddress = source.ModuleBase, + FileName = new string(source.FileName) + }); + return true; + }, IntPtr.Zero); + return files; + } + + // Token: 0x06000035 RID: 53 RVA: 0x00002664 File Offset: 0x00000864 + public int GetTypeIndexFromName(ulong baseAddress, string name) + { + SymbolInfo symbolInfo = SymbolInfo.Create(); + if (!Win32.SymGetTypeFromName(this._hProcess, baseAddress, name, ref symbolInfo)) + { + return 0; + } + return symbolInfo.TypeIndex; + } + + // Token: 0x06000036 RID: 54 RVA: 0x00002690 File Offset: 0x00000890 + public bool GetTypeFromName(ulong baseAddress, string name, ref SymbolInfo type) + { + return Win32.SymGetTypeFromName(this._hProcess, baseAddress, name, ref type); + } + + // Token: 0x06000037 RID: 55 RVA: 0x000026A0 File Offset: 0x000008A0 + public bool Refresh() + { + return Win32.SymRefreshModuleList(this._hProcess); + } + + // Token: 0x06000038 RID: 56 RVA: 0x000026B0 File Offset: 0x000008B0 + public unsafe string GetTypeInfoName(ulong dllBase, int typeIndex) + { + char* value; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Name, out value)) + { + string result = new string(value); + Marshal.FreeCoTaskMem(new IntPtr((void*)value)); + return result; + } + return null; + } + + // Token: 0x06000039 RID: 57 RVA: 0x000026E4 File Offset: 0x000008E4 + public SymbolTag GetSymbolTag(ulong dllBase, int typeIndex) + { + SymbolTag result = SymbolTag.Null; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Tag, out result); + return result; + } + + // Token: 0x0600003A RID: 58 RVA: 0x00002708 File Offset: 0x00000908 + public Variant GetSymbolValue(ulong dllBase, int typeIndex) + { + Variant result = default(Variant); + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Value, out result); + return result; + } + + // Token: 0x0600003B RID: 59 RVA: 0x00002730 File Offset: 0x00000930 + public ulong GetSymbolLength(ulong dllBase, int typeIndex) + { + ulong result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Length, out result); + return result; + } + + // Token: 0x0600003C RID: 60 RVA: 0x00002750 File Offset: 0x00000950 + public int GetSymbolDataKind(ulong dllBase, int typeIndex) + { + int result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.DataKind, out result); + return result; + } + + // Token: 0x0600003D RID: 61 RVA: 0x00002770 File Offset: 0x00000970 + public UdtKind GetSymbolUdtKind(ulong dllBase, int typeIndex) + { + int result; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.UdtKind, out result)) + { + return (UdtKind)result; + } + return UdtKind.Unknown; + } + + // Token: 0x0600003E RID: 62 RVA: 0x00002794 File Offset: 0x00000994 + public int GetSymbolType(ulong dllBase, int typeIndex) + { + int result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Type, out result); + return result; + } + + // Token: 0x0600003F RID: 63 RVA: 0x000027B4 File Offset: 0x000009B4 + public int GetSymbolBitPosition(ulong dllBase, int typeIndex) + { + int result; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.BitPosition, out result)) + { + return result; + } + return -1; + } + + // Token: 0x06000040 RID: 64 RVA: 0x000027D8 File Offset: 0x000009D8 + public int GetSymbolCount(ulong dllBase, int typeIndex) + { + int result = -1; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Count, out result); + return result; + } + + // Token: 0x06000041 RID: 65 RVA: 0x000027FC File Offset: 0x000009FC + public int GetSymbolAddressOffset(ulong dllBase, int typeIndex) + { + int result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.AddressOffset, out result); + return result; + } + + // Token: 0x06000042 RID: 66 RVA: 0x0000281C File Offset: 0x00000A1C + public BasicType GetSymbolBaseType(ulong dllBase, int typeIndex) + { + int result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.BaseType, out result); + return (BasicType)result; + } + + // Token: 0x06000043 RID: 67 RVA: 0x0000283C File Offset: 0x00000A3C + public int GetSymbolOffset(ulong dllBase, int typeIndex) + { + int result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Offset, out result); + return result; + } + + // Token: 0x06000044 RID: 68 RVA: 0x0000285C File Offset: 0x00000A5C + public int GetSymbolChildrenCount(ulong dllBase, int typeIndex) + { + int result; + Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.ChildrenCount, out result); + return result; + } + + // Token: 0x06000045 RID: 69 RVA: 0x0000287C File Offset: 0x00000A7C + public StructDescriptor BuildStructDescriptor(ulong dllBase, int typeIndex) + { + int num; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.ChildrenCount, out num)) + { + StructDescriptor structDescriptor = new StructDescriptor(num); + ulong num2; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.Length, out num2)) + { + structDescriptor.Length = (int)num2; + } + FindChildrenParams findChildrenParams = new FindChildrenParams + { + Count = num + }; + structDescriptor.Length = (int)num2; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, typeIndex, SymbolTypeInfo.FindChildren, ref findChildrenParams)) + { + for (int i = 0; i < findChildrenParams.Count; i++) + { + SymbolInfo symbolInfo = SymbolInfo.Create(); + int num3 = findChildrenParams.Child[i]; + if (this.GetSymbolFromIndex(dllBase, num3, ref symbolInfo)) + { + int offset; + SymbolTag tag; + Variant variant; + if (Win32.SymGetTypeInfo(this._hProcess, dllBase, num3, SymbolTypeInfo.Offset, out offset) && Win32.SymGetTypeInfo(this._hProcess, dllBase, num3, SymbolTypeInfo.Tag, out tag)) + { + symbolInfo.Tag = tag; + symbolInfo.TypeIndex = num3; + StructMember member = new StructMember(ref symbolInfo, offset); + structDescriptor.AddMember(member); + } + else if (Win32.SymGetTypeInfo(this._hProcess, dllBase, num3, SymbolTypeInfo.Value, out variant)) + { + symbolInfo.Tag = SymbolTag.Enum; + symbolInfo.Value = variant.lValue; + symbolInfo.TypeIndex = num3; + StructMember structMember = new StructMember(ref symbolInfo, 0); + int size = symbolInfo.Size; + if (size != 1) + { + if (size != 2) + { + if (size == 8) + { + structMember.Value = variant.lValue; + } + else + { + structMember.Value = (long)variant.iValue; + } + } + else + { + structMember.Value = (long)variant.sValue; + } + } + else + { + structMember.Value = (long)((ulong)variant.bValue); + } + structDescriptor.AddMember(structMember); + } + } + } + } + return structDescriptor; + } + return null; + } + + // Token: 0x0400000E RID: 14 + private static int _instances; + + // Token: 0x0400000F RID: 15 + private IntPtr _hProcess; + + // Token: 0x04000010 RID: 16 + private bool _ownHandle; + } +} diff --git a/PdbServer/PdbPaeser/SymbolInfo.cs b/PdbServer/PdbPaeser/SymbolInfo.cs new file mode 100644 index 0000000..5df935a --- /dev/null +++ b/PdbServer/PdbPaeser/SymbolInfo.cs @@ -0,0 +1,76 @@ +using System; +using System.Runtime.InteropServices; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x0200000C RID: 12 + public struct SymbolInfo + { + // Token: 0x06000046 RID: 70 RVA: 0x00002A24 File Offset: 0x00000C24 + public static SymbolInfo Create() + { + SymbolInfo result = default(SymbolInfo); + result.Init(); + return result; + } + + // Token: 0x06000047 RID: 71 RVA: 0x00002A41 File Offset: 0x00000C41 + public void Init() + { + this.MaxNameLen = 500; + this.SizeOfStruct = 88; + } + + // Token: 0x04000028 RID: 40 + private const int MaxSymbolLen = 500; + + // Token: 0x04000029 RID: 41 + public int SizeOfStruct; + + // Token: 0x0400002A RID: 42 + public int TypeIndex; + + // Token: 0x0400002B RID: 43 + private readonly ulong Reserved1; + + // Token: 0x0400002C RID: 44 + private readonly ulong Reserved2; + + // Token: 0x0400002D RID: 45 + public int Index; + + // Token: 0x0400002E RID: 46 + public int Size; + + // Token: 0x0400002F RID: 47 + public ulong ModuleBase; + + // Token: 0x04000030 RID: 48 + public SymbolFlags Flags; + + // Token: 0x04000031 RID: 49 + public long Value; + + // Token: 0x04000032 RID: 50 + public ulong Address; + + // Token: 0x04000033 RID: 51 + public uint Register; + + // Token: 0x04000034 RID: 52 + public uint Scope; + + // Token: 0x04000035 RID: 53 + public SymbolTag Tag; + + // Token: 0x04000036 RID: 54 + public uint NameLen; + + // Token: 0x04000037 RID: 55 + public int MaxNameLen; + + // Token: 0x04000038 RID: 56 + [MarshalAs(UnmanagedType.ByValTStr, SizeConst = 500)] + public string Name; + } +} diff --git a/PdbServer/PdbPaeser/SymbolOptions.cs b/PdbServer/PdbPaeser/SymbolOptions.cs new file mode 100644 index 0000000..1f60596 --- /dev/null +++ b/PdbServer/PdbPaeser/SymbolOptions.cs @@ -0,0 +1,64 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x0200000D RID: 13 + [Flags] + public enum SymbolOptions : uint + { + // Token: 0x0400003A RID: 58 + None = 0U, + // Token: 0x0400003B RID: 59 + AllowAbsoluteSymbols = 2048U, + // Token: 0x0400003C RID: 60 + AllowZeroAddress = 16777216U, + // Token: 0x0400003D RID: 61 + AutoPublics = 65536U, + // Token: 0x0400003E RID: 62 + CaseInsensitive = 1U, + // Token: 0x0400003F RID: 63 + Debug = 2147483648U, + // Token: 0x04000040 RID: 64 + DeferredLoads = 4U, + // Token: 0x04000041 RID: 65 + DisableSymSrvAutoDetect = 33554432U, + // Token: 0x04000042 RID: 66 + ExactSymbols = 1024U, + // Token: 0x04000043 RID: 67 + FailCriticalErrors = 512U, + // Token: 0x04000044 RID: 68 + FavorCompressed = 8388608U, + // Token: 0x04000045 RID: 69 + FlatDirectory = 4194304U, + // Token: 0x04000046 RID: 70 + IgnoreCodeViewRecord = 128U, + // Token: 0x04000047 RID: 71 + IgnoreImageDir = 2097152U, + // Token: 0x04000048 RID: 72 + IgnoreNTSymbolPath = 4096U, + // Token: 0x04000049 RID: 73 + Include32BitModules = 8192U, + // Token: 0x0400004A RID: 74 + LoadAnything = 64U, + // Token: 0x0400004B RID: 75 + LoadLines = 16U, + // Token: 0x0400004C RID: 76 + NoCPP = 8U, + // Token: 0x0400004D RID: 77 + NoImageSearch = 131072U, + // Token: 0x0400004E RID: 78 + NoPrompts = 524288U, + // Token: 0x0400004F RID: 79 + NoPublics = 32768U, + // Token: 0x04000050 RID: 80 + NoUnqualifiedLoads = 256U, + // Token: 0x04000051 RID: 81 + Overwrite = 1048576U, + // Token: 0x04000052 RID: 82 + PublicsOnly = 16384U, + // Token: 0x04000053 RID: 83 + Secure = 262144U, + // Token: 0x04000054 RID: 84 + UndecorateNames = 2U + } +} diff --git a/PdbServer/PdbPaeser/SymbolTag.cs b/PdbServer/PdbPaeser/SymbolTag.cs new file mode 100644 index 0000000..657bb28 --- /dev/null +++ b/PdbServer/PdbPaeser/SymbolTag.cs @@ -0,0 +1,95 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000014 RID: 20 + public enum SymbolTag + { + // Token: 0x04000073 RID: 115 + Null, + // Token: 0x04000074 RID: 116 + Exe, + // Token: 0x04000075 RID: 117 + Compiland, + // Token: 0x04000076 RID: 118 + CompilandDetails, + // Token: 0x04000077 RID: 119 + CompilandEnv, + // Token: 0x04000078 RID: 120 + Function, + // Token: 0x04000079 RID: 121 + Block, + // Token: 0x0400007A RID: 122 + Data, + // Token: 0x0400007B RID: 123 + Annotation, + // Token: 0x0400007C RID: 124 + Label, + // Token: 0x0400007D RID: 125 + PublicSymbol, + // Token: 0x0400007E RID: 126 + UDT, + // Token: 0x0400007F RID: 127 + Enum, + // Token: 0x04000080 RID: 128 + FunctionType, + // Token: 0x04000081 RID: 129 + PointerType, + // Token: 0x04000082 RID: 130 + ArrayType, + // Token: 0x04000083 RID: 131 + BaseType, + // Token: 0x04000084 RID: 132 + Typedef, + // Token: 0x04000085 RID: 133 + BaseClass, + // Token: 0x04000086 RID: 134 + Friend, + // Token: 0x04000087 RID: 135 + FunctionArgType, + // Token: 0x04000088 RID: 136 + FuncDebugStart, + // Token: 0x04000089 RID: 137 + FuncDebugEnd, + // Token: 0x0400008A RID: 138 + UsingNamespace, + // Token: 0x0400008B RID: 139 + VTableShape, + // Token: 0x0400008C RID: 140 + VTable, + // Token: 0x0400008D RID: 141 + Custom, + // Token: 0x0400008E RID: 142 + Thunk, + // Token: 0x0400008F RID: 143 + CustomType, + // Token: 0x04000090 RID: 144 + ManagedType, + // Token: 0x04000091 RID: 145 + Dimension, + // Token: 0x04000092 RID: 146 + CallSite, + // Token: 0x04000093 RID: 147 + InlineSite, + // Token: 0x04000094 RID: 148 + BaseInterface, + // Token: 0x04000095 RID: 149 + VectorType, + // Token: 0x04000096 RID: 150 + MatrixType, + // Token: 0x04000097 RID: 151 + HLSLType, + // Token: 0x04000098 RID: 152 + Caller, + // Token: 0x04000099 RID: 153 + Callee, + // Token: 0x0400009A RID: 154 + Export, + // Token: 0x0400009B RID: 155 + HeapAllocationSite, + // Token: 0x0400009C RID: 156 + CoffGroup, + // Token: 0x0400009D RID: 157 + Max + } +} diff --git a/PdbServer/PdbPaeser/SymbolTypeInfo.cs b/PdbServer/PdbPaeser/SymbolTypeInfo.cs new file mode 100644 index 0000000..82cf023 --- /dev/null +++ b/PdbServer/PdbPaeser/SymbolTypeInfo.cs @@ -0,0 +1,75 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000015 RID: 21 + public enum SymbolTypeInfo + { + // Token: 0x0400009F RID: 159 + Tag, + // Token: 0x040000A0 RID: 160 + Name, + // Token: 0x040000A1 RID: 161 + Length, + // Token: 0x040000A2 RID: 162 + Type, + // Token: 0x040000A3 RID: 163 + TypeId, + // Token: 0x040000A4 RID: 164 + BaseType, + // Token: 0x040000A5 RID: 165 + ArrayIndexTypeId, + // Token: 0x040000A6 RID: 166 + FindChildren, + // Token: 0x040000A7 RID: 167 + DataKind, + // Token: 0x040000A8 RID: 168 + AddressOffset, + // Token: 0x040000A9 RID: 169 + Offset, + // Token: 0x040000AA RID: 170 + Value, + // Token: 0x040000AB RID: 171 + Count, + // Token: 0x040000AC RID: 172 + ChildrenCount, + // Token: 0x040000AD RID: 173 + BitPosition, + // Token: 0x040000AE RID: 174 + VirtualBaseClass, + // Token: 0x040000AF RID: 175 + VIRTUALTABLESHAPEID, + // Token: 0x040000B0 RID: 176 + VIRTUALBASEPOINTEROFFSET, + // Token: 0x040000B1 RID: 177 + ClassParentId, + // Token: 0x040000B2 RID: 178 + Nested, + // Token: 0x040000B3 RID: 179 + SymIndex, + // Token: 0x040000B4 RID: 180 + LexicalParent, + // Token: 0x040000B5 RID: 181 + Address, + // Token: 0x040000B6 RID: 182 + ThisAdjust, + // Token: 0x040000B7 RID: 183 + UdtKind, + // Token: 0x040000B8 RID: 184 + IsEquivalentTo, + // Token: 0x040000B9 RID: 185 + CallingConvention, + // Token: 0x040000BA RID: 186 + IsCloseEquivalentTo, + // Token: 0x040000BB RID: 187 + GTIEX_REQS_VALID, + // Token: 0x040000BC RID: 188 + VirtualBaseOffset, + // Token: 0x040000BD RID: 189 + VirtualBaseDispIndex, + // Token: 0x040000BE RID: 190 + IsReference, + // Token: 0x040000BF RID: 191 + IndirectVirtualBaseClass + } +} diff --git a/PdbServer/PdbPaeser/System/Runtime/CompilerServices/IsReadOnlyAttribute.cs b/PdbServer/PdbPaeser/System/Runtime/CompilerServices/IsReadOnlyAttribute.cs new file mode 100644 index 0000000..5f28270 --- /dev/null +++ b/PdbServer/PdbPaeser/System/Runtime/CompilerServices/IsReadOnlyAttribute.cs @@ -0,0 +1 @@ + \ No newline at end of file diff --git a/PdbServer/PdbPaeser/UdtKind.cs b/PdbServer/PdbPaeser/UdtKind.cs new file mode 100644 index 0000000..0dca6b3 --- /dev/null +++ b/PdbServer/PdbPaeser/UdtKind.cs @@ -0,0 +1,19 @@ +using System; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000013 RID: 19 + public enum UdtKind + { + // Token: 0x0400006D RID: 109 + Struct, + // Token: 0x0400006E RID: 110 + Class, + // Token: 0x0400006F RID: 111 + Union, + // Token: 0x04000070 RID: 112 + Interface, + // Token: 0x04000071 RID: 113 + Unknown = 99 + } +} diff --git a/PdbServer/PdbPaeser/Variant.cs b/PdbServer/PdbPaeser/Variant.cs new file mode 100644 index 0000000..faca72e --- /dev/null +++ b/PdbServer/PdbPaeser/Variant.cs @@ -0,0 +1,40 @@ +using System; +using System.Runtime.InteropServices; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000017 RID: 23 + [StructLayout(LayoutKind.Explicit, Size = 16)] + public struct Variant + { + // Token: 0x06000050 RID: 80 RVA: 0x00002A56 File Offset: 0x00000C56 + public override string ToString() + { + return string.Format("VT: {0} iValue: {1}", this.vt, this.iValue); + } + + // Token: 0x040000C3 RID: 195 + [FieldOffset(0)] + public short vt; + + // Token: 0x040000C4 RID: 196 + [FieldOffset(8)] + public double dValue; + + // Token: 0x040000C5 RID: 197 + [FieldOffset(8)] + public int iValue; + + // Token: 0x040000C6 RID: 198 + [FieldOffset(8)] + public long lValue; + + // Token: 0x040000C7 RID: 199 + [FieldOffset(8)] + public byte bValue; + + // Token: 0x040000C8 RID: 200 + [FieldOffset(8)] + public short sValue; + } +} diff --git a/PdbServer/PdbPaeser/Win32.cs b/PdbServer/PdbPaeser/Win32.cs new file mode 100644 index 0000000..7120a98 --- /dev/null +++ b/PdbServer/PdbPaeser/Win32.cs @@ -0,0 +1,107 @@ +using System; +using System.Runtime.InteropServices; +using System.Security; + +namespace Zodiacon.DebugHelp +{ + // Token: 0x02000018 RID: 24 + [SuppressUnmanagedCodeSecurity] + internal static class Win32 + { + // Token: 0x06000051 RID: 81 + [DllImport("kernel32", SetLastError = true)] + public static extern bool CloseHandle(IntPtr handle); + + // Token: 0x06000052 RID: 82 + [DllImport("kernel32", SetLastError = true)] + public static extern IntPtr OpenProcess(ProcessAccessMask access, bool inheritHandle, int pid); + + // Token: 0x06000053 RID: 83 + [DllImport("dbghelp", SetLastError = true)] + public static extern SymbolOptions SymSetOptions(SymbolOptions options); + + // Token: 0x06000054 RID: 84 + [DllImport("dbghelp", CharSet = CharSet.Unicode, EntryPoint = "SymInitializeW", ExactSpelling = true, SetLastError = true)] + public static extern bool SymInitialize(IntPtr hProcess, string searchPath, bool invadeProcess); + + // Token: 0x06000055 RID: 85 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymCleanup(IntPtr hProcess); + + // Token: 0x06000056 RID: 86 + [DllImport("dbghelp", CharSet = CharSet.Unicode, EntryPoint = "SymLoadModuleExW", ExactSpelling = true, SetLastError = true)] + public static extern ulong SymLoadModuleEx(IntPtr hProcess, IntPtr hFile, string imageName, string moduleName, ulong baseOfDll, uint dllSize, IntPtr data, uint flags); + + // Token: 0x06000057 RID: 87 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymFromAddr(IntPtr hProcess, ulong address, out ulong displacement, ref SymbolInfo symbol); + + // Token: 0x06000058 RID: 88 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymEnumerateModules64(IntPtr hProcess, SymEnumerateModuleProc proc, IntPtr context); + + // Token: 0x06000059 RID: 89 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymRefreshModuleList(IntPtr hProcess); + + // Token: 0x0600005A RID: 90 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymFromName(IntPtr hProcess, string name, ref SymbolInfo symbol); + + // Token: 0x0600005B RID: 91 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymEnumSymbols(IntPtr hProcess, ulong baseOfDll, string mask, Win32.EnumSymbolCallback callback, IntPtr context); + + // Token: 0x0600005C RID: 92 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymEnumTypes(IntPtr hProcess, ulong baseOfDll, Win32.EnumSymbolCallback callback, IntPtr context); + + // Token: 0x0600005D RID: 93 + [DllImport("dbghelp", CharSet = CharSet.Unicode, SetLastError = true)] + public static extern bool SymEnumSourceFiles(IntPtr hProcess, ulong baseOfDll, string mask, EnumSourceFilesCallback callback, IntPtr context); + + // Token: 0x0600005E RID: 94 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymEnumTypesByName(IntPtr hProcess, ulong baseOfDll, string mask, Win32.EnumSymbolCallback callback, IntPtr context); + + // Token: 0x0600005F RID: 95 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, out int value); + + // Token: 0x06000060 RID: 96 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, out SymbolTag tag); + + // Token: 0x06000061 RID: 97 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, out UdtKind tag); + + // Token: 0x06000062 RID: 98 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, out Variant value); + + // Token: 0x06000063 RID: 99 + [DllImport("dbghelp", SetLastError = true)] + public unsafe static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, out char* value); + + // Token: 0x06000064 RID: 100 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, out ulong value); + + // Token: 0x06000065 RID: 101 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymGetTypeInfo(IntPtr hProcess, ulong baseOfDll, int typeId, SymbolTypeInfo typeinfo, ref FindChildrenParams value); + + // Token: 0x06000066 RID: 102 + [DllImport("dbghelp", SetLastError = true)] + public static extern bool SymFromIndex(IntPtr hProcess, ulong dllBase, int index, ref SymbolInfo symbol); + + // Token: 0x06000067 RID: 103 + [DllImport("dbghelp", CharSet = CharSet.Unicode, SetLastError = true)] + public static extern bool SymGetTypeFromName(IntPtr hProcess, ulong dllBase, string name, ref SymbolInfo symbol); + + // Token: 0x0200001E RID: 30 + // (Invoke) Token: 0x06000073 RID: 115 + public delegate bool EnumSymbolCallback(ref SymbolInfo symbol, uint symbolSize, IntPtr context); + } +} diff --git a/PdbServer/PdbServer.csproj b/PdbServer/PdbServer.csproj new file mode 100644 index 0000000..e9cda8d --- /dev/null +++ b/PdbServer/PdbServer.csproj @@ -0,0 +1,16 @@ + + + + net6.0 + enable + enable + True + + + + + + + + + diff --git a/PdbServer/Program.cs b/PdbServer/Program.cs new file mode 100644 index 0000000..a718f6f --- /dev/null +++ b/PdbServer/Program.cs @@ -0,0 +1,70 @@ +using System.Net; +using System.Net.Http.Headers; +using System.Text; + +using Microsoft.AspNetCore.Http; +using Microsoft.AspNetCore.Http.Features; +using Microsoft.AspNetCore.Mvc; + +var builder = WebApplication.CreateBuilder(args); + +// Add services to the container. + +builder.Services.AddControllers(); +// Learn more about configuring Swagger/OpenAPI at https://aka.ms/aspnetcore/swashbuckle +builder.Services.AddEndpointsApiExplorer(); +builder.Services.AddSwaggerGen(); + +var app = builder.Build(); +// Configure the HTTP request pipeline. +if (app.Environment.IsDevelopment()) +{ + app.UseSwagger(); + app.UseSwaggerUI(); +} +app.UseHttpsRedirection(); + +app.UseAuthorization(); + +app.MapControllers(); + + +const string selfdocpath = "D:\\Web"; +app.MapGet("/",(HttpContext context) => +{ + byte[] data = File.ReadAllBytes("D:\\Web\\main.html"); + context.Response.Body.WriteAsync(data, 0, data.Length); +}); + +app.Run(); +/* + + + + + + + + +PDB + + +

PDB

+

һ΢ٷpdbͬķļ

+

ڴ½ʹ,ӵиķٶ,͵ӳ

+

ṩĵַ,Խ뵽Ļ(_NT_SYMBOL_PATH)

+

http://www.sym101.com/download/symbols

+ + + +*/ \ No newline at end of file diff --git a/PdbServer/Properties/launchSettings.json b/PdbServer/Properties/launchSettings.json new file mode 100644 index 0000000..6f39ef8 --- /dev/null +++ b/PdbServer/Properties/launchSettings.json @@ -0,0 +1,31 @@ +{ + "$schema": "https://json.schemastore.org/launchsettings.json", + "iisSettings": { + "windowsAuthentication": false, + "anonymousAuthentication": true, + "iisExpress": { + "applicationUrl": "http://localhost:1282", + "sslPort": 44300 + } + }, + "profiles": { + "PdbServer": { + "commandName": "Project", + "dotnetRunMessages": true, + "launchBrowser": true, + "launchUrl": "swagger", + "applicationUrl": "https://localhost:7001;http://localhost:5001", + "environmentVariables": { + "ASPNETCORE_ENVIRONMENT": "Development" + } + }, + "IIS Express": { + "commandName": "IISExpress", + "launchBrowser": true, + "launchUrl": "swagger", + "environmentVariables": { + "ASPNETCORE_ENVIRONMENT": "Development" + } + } + } +} diff --git a/PdbServer/appsettings.Development.json b/PdbServer/appsettings.Development.json new file mode 100644 index 0000000..0c208ae --- /dev/null +++ b/PdbServer/appsettings.Development.json @@ -0,0 +1,8 @@ +{ + "Logging": { + "LogLevel": { + "Default": "Information", + "Microsoft.AspNetCore": "Warning" + } + } +} diff --git a/PdbServer/appsettings.json b/PdbServer/appsettings.json new file mode 100644 index 0000000..10f68b8 --- /dev/null +++ b/PdbServer/appsettings.json @@ -0,0 +1,9 @@ +{ + "Logging": { + "LogLevel": { + "Default": "Information", + "Microsoft.AspNetCore": "Warning" + } + }, + "AllowedHosts": "*" +} diff --git a/PdbServer/index.html b/PdbServer/index.html new file mode 100644 index 0000000..cc4bdd4 --- /dev/null +++ b/PdbServer/index.html @@ -0,0 +1,14 @@ + + + + + PDB缓存服务器 + + +

PDB服务

+

这是一个与微软官方pdb服务器同步的符号文件缓存服务器

+

你可以在大陆使用这个,它拥有更快的访问速度,与更低的连接延迟

+

下面是提供服务的地址,你可以将它加入到你的环境变量(_NT_SYMBOL_PATH)

+

http://www.sym101.com/download/symbols

+ + \ No newline at end of file diff --git a/UpLoader/HTTP/CHttpHeader.cpp b/UpLoader/HTTP/CHttpHeader.cpp new file mode 100644 index 0000000..560d850 --- /dev/null +++ b/UpLoader/HTTP/CHttpHeader.cpp @@ -0,0 +1,175 @@ +#include "CHttpHeader.h" +CHttpHeader::CHttpHeader() + : http_code_(0) +{ + +} + +CHttpHeader::CHttpHeader(const char* pHeader) + : http_code_(0) +{ + Revolse(std::string(pHeader)); +} + +CHttpHeader::CHttpHeader(const std::string& strHeader) + : http_code_(0) +{ + Revolse(strHeader); +} + +CHttpHeader::CHttpHeader(CHttpHeader&& rhs) +{ + this->http_code_ = rhs.http_code_; + this->http_version_ = std::move(rhs.http_version_); + this->http_response_ = std::move(rhs.http_response_); + this->request_page_ = std::move(rhs.request_page_); + this->http_headers = std::move(rhs.http_headers); +} + +CHttpHeader::~CHttpHeader(void) +{ +} + +std::string CHttpHeader::GetValue(const std::string& strKey) +{ + std::string strResult; + std::map::const_iterator itor; + itor = http_headers.find(strKey); + if (itor != http_headers.end()) + strResult = itor->second; + return strResult; +} + +void CHttpHeader::addHeader(const std::string& key, const std::string& value) +{ + if (key.empty() || value.empty()) { + return; + } + http_headers.insert(std::make_pair(key, value)); +} + +void CHttpHeader::setUserAgent(const std::string& userAgent) +{ + if (userAgent.empty()) { + return; + } + http_headers.insert(std::make_pair(HEADER_USER_AGENT, userAgent)); +} + +void CHttpHeader::setHost(const std::string& host) +{ + if (host.empty()) { + return; + } + http_headers.insert(std::make_pair(HEADER_HOST, host)); +} + +void CHttpHeader::setRange(__int64 range) +{ + if (range < 0) { + return; + } + char buffer[64] = { 0 }; + sprintf_s(buffer, "bytes=%i64d-", range); + http_headers.insert(std::make_pair(HEADER_RANGE, std::string(buffer))); +} + +std::string CHttpHeader::toString(HttpRequestType type) +{ + //Ĭֵ + if (http_version_.empty()) { + http_version_.assign(default_http_version); + } + if (http_headers.find(HEADER_USER_AGENT) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_USER_AGENT, default_user_agent)); + } + if (http_headers.find(HEADER_CONNECTION) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_USER_AGENT, default_http_version)); + } + if (http_headers.find(HEADER_ACCEPT) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_ACCEPT, default_accept)); + } + if (http_headers.find(HEADER_CONNECTION) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_CONNECTION, default_connection)); + } + if (http_headers.find(HEADER_ACCEPT_LANGUAGE) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_ACCEPT_LANGUAGE, default_language)); + } + std::string header((type == HttpPost) ? "POST " : "GET "); + header += request_page_; + header.append(" "); + header += http_version_; + header.append(http_newline); + for (auto itor = http_headers.begin(); itor != http_headers.end(); ++itor) { + header += itor->first; + header.append(": "); + header += itor->second; + header.append(http_newline); + } + header.append(http_newline); + header.append(http_newline); + return std::move(header); +} + +std::string CHttpHeader::toHttpHeaders() +{ + if (http_headers.find(HEADER_USER_AGENT) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_USER_AGENT, default_user_agent)); + } + if (http_headers.find(HEADER_CONNECTION) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_USER_AGENT, default_http_version)); + } + if (http_headers.find(HEADER_ACCEPT) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_ACCEPT, default_accept)); + } + if (http_headers.find(HEADER_CONNECTION) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_CONNECTION, default_connection)); + } + if (http_headers.find(HEADER_ACCEPT_LANGUAGE) == http_headers.end()) { + http_headers.insert(std::make_pair(HEADER_ACCEPT_LANGUAGE, default_language)); + } + std::string header; + for (auto itor = http_headers.begin(); itor != http_headers.end(); ++itor) { + header += itor->first; + header.append(": "); + header += itor->second; + header.append(http_newline); + } + return std::move(header); +} + +bool CHttpHeader::Revolse(const std::string& strHeader) +{ + int nStartPos = 0, nFindPos = 0, nLineIndex = 0; + std::string strLine, strKey, strValue; + do + { + nFindPos = strHeader.find("\r\n", nStartPos); + if (-1 == nFindPos) + strLine = strHeader.substr(nStartPos, strHeader.size() - nStartPos); + else + { + strLine = strHeader.substr(nStartPos, nFindPos - nStartPos); + nStartPos = nFindPos + 2; + } + if (0 == nLineIndex)//һ + { + http_version_ = strLine.substr(0, 8); + int nSpace1 = strLine.find(" "); + int nSpace2 = strLine.find(" ", nSpace1 + 1); + http_code_ = atoi(strLine.substr(nSpace1 + 1, nSpace2 - nSpace1 - 1).c_str()); + http_response_ = strLine.substr(nSpace2 + 1, strLine.size() - nSpace2 - 1); + nLineIndex++; + continue; + } + int nSplit = strLine.find(": "); + strKey = strLine.substr(0, nSplit); + strValue = strLine.substr(nSplit + 2, strLine.size() - nSplit - 2); + std::pair data; + data.first = strKey; + data.second = strValue; + http_headers.insert(std::move(data)); + nLineIndex++; + } while (nFindPos != -1); + return true; +} \ No newline at end of file diff --git a/UpLoader/HTTP/CHttpHeader.h b/UpLoader/HTTP/CHttpHeader.h new file mode 100644 index 0000000..27462f1 --- /dev/null +++ b/UpLoader/HTTP/CHttpHeader.h @@ -0,0 +1,50 @@ +#pragma once +#include +#include +#include +#include +#include +#include +#include "http_defines.h" +using namespace std; +class CHttpHeader +{ +public: + CHttpHeader(); + CHttpHeader(const char* pHeader); + CHttpHeader(const std::string& strHeader); + CHttpHeader(CHttpHeader&& rhs); + virtual ~CHttpHeader(void); + + + const std::string& getHttpVersion()const { return http_version_; } + void setHttpVersion(const std::string& version) { http_version_ = version; } + void setRequestPath(const std::string& path) { request_page_ = path; } + + const int GetHttpCode()const { return http_code_; } + + const char* GetContent()const { return http_response_.c_str(); } + + std::string GetValue(const std::string& strKey); + + void addHeader(const std::string& key, const std::string& value); + void setUserAgent(const std::string& userAgent); + void setHost(const std::string& host); + void setRange(__int64 range); + + //תhttpͷ + std::string toString(HttpRequestType type); + //תhttpͷб + std::string toHttpHeaders(); + +protected: + //HTTPͷṹ + bool Revolse(const std::string& strHeader); + +private: + int http_code_; + std::string http_version_; + std::string http_response_; + std::string request_page_; + std::map http_headers; +}; \ No newline at end of file diff --git a/UpLoader/HTTP/HttpClient.cpp b/UpLoader/HTTP/HttpClient.cpp new file mode 100644 index 0000000..af6134c --- /dev/null +++ b/UpLoader/HTTP/HttpClient.cpp @@ -0,0 +1,401 @@ +#include "HttpClient.h" +#include "http_common.h" +inline void CloseInternetHandle(HINTERNET* hInternet) +{ + if (*hInternet) + { + WinHttpCloseHandle(*hInternet); + *hInternet = NULL; + } +} + + +HttpClient::HttpClient(void) + : m_hInternet(NULL) + , m_hConnect(NULL) + , m_hRequest(NULL) + , m_nConnTimeout(500000) + , m_nSendTimeout(500000) + , m_nRecvTimeout(500000) + , m_bHttps(false) + , m_nResponseCode(0) +{ + memset(&m_paramsData, 0, sizeof(HttpParamsData)); + Init(); +} + +HttpClient::~HttpClient(void) +{ + Release(); +} + +bool HttpClient::Init() +{ + m_hInternet = ::WinHttpOpen( + L"Microsoft Internet Explorer", + WINHTTP_ACCESS_TYPE_DEFAULT_PROXY, + WINHTTP_NO_PROXY_NAME, + WINHTTP_NO_PROXY_BYPASS, + 0); + if (NULL == m_hInternet) + { + m_paramsData.errcode = HttpErrorInit; + return false; + } + ::WinHttpSetTimeouts(m_hInternet, 0, m_nConnTimeout, m_nSendTimeout, m_nRecvTimeout); + return true; +} + +void HttpClient::Release() +{ + CloseInternetHandle(&m_hRequest); + CloseInternetHandle(&m_hConnect); + CloseInternetHandle(&m_hInternet); +} + +bool HttpClient::ConnectHttpServer(LPCWSTR lpIP, WORD wPort) +{ + m_hConnect = ::WinHttpConnect(m_hInternet, lpIP, wPort, 0); + return m_hConnect != NULL; +} + +bool HttpClient::CreateHttpRequest(LPCWSTR lpPage, HttpRequestType type, DWORD dwFlag/*=0*/) +{ + const wchar_t* pVerb = (type == HttpGet) ? L"GET" : L"POST"; + m_hRequest = ::WinHttpOpenRequest( + m_hConnect, + pVerb, + lpPage, + NULL, + WINHTTP_NO_REFERER, + WINHTTP_DEFAULT_ACCEPT_TYPES, + dwFlag); + return m_hRequest != NULL; +} + +void HttpClient::SetTimeOut(int dwConnectTime, int dwSendTime, int dwRecvTime) +{ + m_nConnTimeout = dwConnectTime; + m_nSendTimeout = dwSendTime; + m_nRecvTimeout = dwRecvTime; +} + +bool HttpClient::DownloadFile(LPCWSTR lpUrl, LPCWSTR lpFilePath) +{ + Release(); + if (!Init()) + return false; + bool bRet = false; + DWORD dwBytesToRead = 0, dwFileSize = 0, dwReadSize = 0, dwRecvSize = 0; + if (!InitConnect(lpUrl, HttpGet)) + return false; + if (!QueryContentLength(dwFileSize)) + { + m_paramsData.errcode = HttpErrorQuery; + return false; + } + m_nResponseCode = QueryStatusCode(); + if (m_nResponseCode == HTTP_STATUS_NOT_FOUND) { + m_paramsData.errcode = HttpError404; + return false; + } + HANDLE hFile = CreateFile(lpFilePath, GENERIC_WRITE, FILE_SHARE_WRITE, NULL, CREATE_ALWAYS, FILE_ATTRIBUTE_NORMAL, NULL); + if (INVALID_HANDLE_VALUE == hFile) + { + m_paramsData.errcode = HttpErrorCreateFile; + return false; + } + SetFilePointer(hFile, dwFileSize, 0, FILE_BEGIN); + SetEndOfFile(hFile); + SetFilePointer(hFile, 0, NULL, FILE_BEGIN); + if (!::WinHttpQueryDataAvailable(m_hRequest, &dwBytesToRead)) + { + CloseHandle(hFile); + DeleteFile(lpFilePath); + return false; + } + void* lpBuff = malloc(READ_BUFFER_SIZE); + while (true) + { + if (dwBytesToRead > READ_BUFFER_SIZE) + { + free(lpBuff); + lpBuff = malloc(dwBytesToRead); + } + if (!::WinHttpReadData(m_hRequest, lpBuff, dwBytesToRead, &dwReadSize)) + break; + DWORD dwWriteByte; + if (!WriteFile(hFile, lpBuff, dwReadSize, &dwWriteByte, NULL) || (dwReadSize != dwWriteByte)) + break; + dwRecvSize += dwReadSize; + if (m_paramsData.callback) + m_paramsData.callback->OnDownloadCallback(m_paramsData.lpparam, HttpLoading, dwFileSize, dwRecvSize); + if (!::WinHttpQueryDataAvailable(m_hRequest, &dwBytesToRead)) + break; + if (dwBytesToRead <= 0) + { + bRet = true; + break; + } + } + free(lpBuff); + CloseHandle(hFile); + if (!bRet) + {//ʧܣɾļ + DeleteFile(lpFilePath); + } + return bRet; +} + +bool HttpClient::DownloadToMem(LPCWSTR lpUrl, OUT void** ppBuffer, OUT int* nSize) +{ + bool bResult = false; + BYTE* lpFileMem = NULL; + void* lpBuff = NULL; + DWORD dwLength = 0, dwBytesToRead = 0, dwReadSize = 0, dwRecvSize = 0; + try + { + if (!InitConnect(lpUrl, HttpGet)) + throw HttpErrorInit; + if (!QueryContentLength(dwLength)) + throw HttpErrorQuery; + m_nResponseCode = QueryStatusCode(); + if (m_nResponseCode == HTTP_STATUS_NOT_FOUND) { + throw HttpError404; + } + if (!::WinHttpQueryDataAvailable(m_hRequest, &dwBytesToRead)) + throw HttpErrorQuery; + if (dwLength > DOWNLOAD_BUFFER_SIZE) + throw HttpErrorBuffer;//ļСԤֵصڴ + lpFileMem = (BYTE*)malloc(dwLength); + lpBuff = malloc(READ_BUFFER_SIZE); + while (true) + { + if (dwBytesToRead > READ_BUFFER_SIZE) + { + free(lpBuff); + lpBuff = malloc(dwBytesToRead); + } + if (!::WinHttpReadData(m_hRequest, lpBuff, dwBytesToRead, &dwReadSize)) + throw HttpErrorDownload; + memcpy(lpFileMem + dwRecvSize, lpBuff, dwReadSize); + dwRecvSize += dwReadSize; + if (!::WinHttpQueryDataAvailable(m_hRequest, &dwBytesToRead)) + throw HttpErrorDownload; + if (dwBytesToRead <= 0) + { + bResult = true; + break; + } + } + } + catch (HttpInterfaceError error) + { + m_paramsData.errcode = error; + } + if (lpBuff) + free(lpBuff); + if (bResult) + { + *ppBuffer = lpFileMem; + *nSize = dwRecvSize; + } + else + free(lpFileMem); + return bResult; +} + +void HttpClient::SetDownloadCallback(IHttpCallback* pCallback, void* pParam) +{ + m_paramsData.callback = pCallback; + m_paramsData.lpparam = pParam; +} + +void HttpClient::AddHeader(LPCSTR key, LPCSTR value) +{ + if (isEmptyString(key) || isEmptyString(value)) { + return; + } + m_header.addHeader(string(key), string(value)); +} + +string HttpClient::Request(LPCSTR lpUrl, HttpRequestType type, void* lpPostData /*= NULL*/, LPCSTR lpHeader/*=NULL*/) +{ + string strRet; + wstring strUrl = A2U(string(lpUrl)); + if (!InitConnect(strUrl.c_str(), type, lpPostData, 0, (lpHeader == NULL) ? NULL : A2U(string(lpHeader)).c_str())) + return strRet; + m_nResponseCode = QueryStatusCode(); + if (m_nResponseCode == HTTP_STATUS_NOT_FOUND) { + throw HttpError404; + } + DWORD dwBytesToRead, dwReadSize; + void* lpBuff = malloc(READ_BUFFER_SIZE); + bool bFinish = false; + while (true) + { + if (!::WinHttpQueryDataAvailable(m_hRequest, &dwBytesToRead)) + break; + if (dwBytesToRead <= 0) + { + bFinish = true; + break; + } + if (dwBytesToRead > READ_BUFFER_SIZE) + { + free(lpBuff); + lpBuff = malloc(dwBytesToRead); + } + if (!::WinHttpReadData(m_hRequest, lpBuff, dwBytesToRead, &dwReadSize)) + break; + strRet.append((const char*)lpBuff, dwReadSize); + } + free(lpBuff); + if (!bFinish) + strRet.clear(); + return strRet; +} + +string HttpClient::Request(LPCWSTR lpUrl, HttpRequestType type, void* lpPostData /*= NULL*/, int datelen, LPCWSTR lpHeader/*=NULL*/) +{ + string strRet; + if (!InitConnect(lpUrl, type, lpPostData, datelen, lpHeader)) + return strRet; + m_nResponseCode = QueryStatusCode(); + if (m_nResponseCode == HTTP_STATUS_NOT_FOUND) { + throw HttpError404; + } + DWORD dwBytesToRead, dwReadSize; + void* lpBuff = malloc(READ_BUFFER_SIZE); + bool bFinish = false; + while (true) + { + if (!::WinHttpQueryDataAvailable(m_hRequest, &dwBytesToRead)) + break; + if (dwBytesToRead <= 0) + { + bFinish = true; + break; + } + if (dwBytesToRead > READ_BUFFER_SIZE) + { + free(lpBuff); + lpBuff = malloc(dwBytesToRead); + } + if (!::WinHttpReadData(m_hRequest, lpBuff, dwBytesToRead, &dwReadSize)) + break; + strRet.append((const char*)lpBuff, dwReadSize); + } + free(lpBuff); + if (!bFinish) + strRet.clear(); + return strRet; +} + +string HttpClient::Get(LPCWSTR lpUrl) +{ + return this->Request(lpUrl, HttpGet); +} +string HttpClient::Post(LPCWSTR lpUrl,const void* lpPostData, int datelen, LPCWSTR lpHeader) +{ + return this->Request(lpUrl, HttpPost,(void*) lpPostData, datelen, lpHeader); +} +bool HttpClient::QueryRawHeaders(OUT wstring& strHeaders) +{ + bool bRet = false; + DWORD dwSize; + BOOL bResult = ::WinHttpQueryHeaders(m_hRequest, WINHTTP_QUERY_RAW_HEADERS, WINHTTP_HEADER_NAME_BY_INDEX, NULL, &dwSize, WINHTTP_NO_HEADER_INDEX); + if (ERROR_INSUFFICIENT_BUFFER == GetLastError()) + { + wchar_t* lpData = (wchar_t*)malloc(dwSize); + bResult = ::WinHttpQueryHeaders(m_hRequest, WINHTTP_QUERY_RAW_HEADERS, WINHTTP_HEADER_NAME_BY_INDEX, lpData, &dwSize, WINHTTP_NO_HEADER_INDEX); + if (bResult) + { + strHeaders = lpData; + bRet = true; + } + free(lpData); + } + return bRet; +} + +bool HttpClient::QueryContentLength(OUT DWORD& dwLength) +{ + bool bRet = false; + wchar_t szBuffer[24] = { 0 }; + DWORD dwSize = 24 * sizeof(wchar_t); + if (::WinHttpQueryHeaders(m_hRequest, WINHTTP_QUERY_CONTENT_LENGTH, WINHTTP_HEADER_NAME_BY_INDEX, szBuffer, &dwSize, WINHTTP_NO_HEADER_INDEX)) + { + TCHAR* p = NULL; + dwLength = wcstoul(szBuffer, &p, 10); + bRet = true; + } + return bRet; +} + +int HttpClient::QueryStatusCode() +{ + int http_code = 0; + wchar_t szBuffer[24] = { 0 }; + DWORD dwSize = 24 * sizeof(wchar_t); + if (::WinHttpQueryHeaders(m_hRequest, WINHTTP_QUERY_STATUS_CODE, WINHTTP_HEADER_NAME_BY_INDEX, szBuffer, &dwSize, WINHTTP_NO_HEADER_INDEX)) { + wchar_t* p = NULL; + http_code = wcstoul(szBuffer, &p, 10); + } + return http_code; +} + +bool HttpClient::InitConnect(LPCWSTR lpUrl, HttpRequestType type, void* lpPostData/*=NULL*/, int datelen, LPCWSTR lpHeader/*=NULL*/) +{ + Release(); + if (!Init()) + return false; + wstring strHostName, strPage; + WORD wPort; + MyParseUrlW(lpUrl, strHostName, strPage, wPort); + if (wPort == INTERNET_DEFAULT_HTTPS_PORT) + m_bHttps = true; + if (!ConnectHttpServer(strHostName.c_str(), wPort)) + { + m_paramsData.errcode = HttpErrorConnect; + return false; + } + DWORD dwFlag = m_bHttps ? WINHTTP_FLAG_SECURE : 0; + if (!CreateHttpRequest(strPage.c_str(), type, dwFlag)) + { + m_paramsData.errcode = HttpErrorInit; + return false; + } + if (m_bHttps) + { + DWORD dwFlags = SECURITY_FLAG_SECURE | + SECURITY_FLAG_IGNORE_UNKNOWN_CA | + SECURITY_FLAG_IGNORE_CERT_WRONG_USAGE | + SECURITY_FLAG_IGNORE_CERT_CN_INVALID | + SECURITY_FLAG_IGNORE_CERT_DATE_INVALID; + WinHttpSetOption(m_hRequest, WINHTTP_OPTION_SECURITY_FLAGS, &dwFlags, sizeof(dwFlags)); + } + if (!SendHttpRequest(lpPostData, datelen, lpHeader)) + { + m_paramsData.errcode = HttpErrorSend; + return false; + } + if (!WinHttpReceiveResponse(m_hRequest, NULL)) + { + m_paramsData.errcode = HttpErrorInit; + return false; + } + return true; +} + +bool HttpClient::SendHttpRequest(void* lpPostData/*=NULL*/,int datelen, LPCWSTR lpHeader/*=NULL*/) +{ + //HTTPͷ + std::wstring header = A2U(m_header.toHttpHeaders()); + ::WinHttpAddRequestHeaders(m_hRequest, header.c_str(), header.size(), WINHTTP_ADDREQ_FLAG_ADD | WINHTTP_ADDREQ_FLAG_REPLACE); + if (lpHeader == NULL) + return ::WinHttpSendRequest(m_hRequest, WINHTTP_NO_ADDITIONAL_HEADERS, 0, lpPostData, datelen, datelen, NULL) == TRUE; + else + return ::WinHttpSendRequest(m_hRequest, lpHeader, -1L, lpPostData, datelen, datelen, NULL) == TRUE; +} + diff --git a/UpLoader/HTTP/HttpClient.h b/UpLoader/HTTP/HttpClient.h new file mode 100644 index 0000000..0181b53 --- /dev/null +++ b/UpLoader/HTTP/HttpClient.h @@ -0,0 +1,51 @@ +#pragma once +#include "CHttpHeader.h" +using namespace std; +#define CONTENTTYPE_JSON L"Content-Type: application/json;" +#define CONTENTTYPE_TEXT L"Content-Type: text/html;" +#define CONTENTTYPE_URLENCODED L"Content-Type: application/x-www-form-urlencoded;charset:utf-8;" +class HttpClient +{ +public: + HttpClient(void); + ~HttpClient(void); + + void SetTimeOut(int dwConnectTime, int dwSendTime, int dwRecvTime); + string Request(LPCSTR lpUrl, HttpRequestType type, void* lpPostData = NULL, LPCSTR lpHeader = NULL); + string Request(LPCWSTR lpUrl, HttpRequestType type, void* lpPostData = NULL, int datelen = 0, LPCWSTR lpHeader = NULL); + string Get(LPCWSTR lpUrl); + string Post(LPCWSTR lpUrl,const void* lpPostData = NULL, int datelen = 0, LPCWSTR lpHeader = NULL); + void FreeInstance() { delete this; } + bool DownloadFile(LPCWSTR lpUrl, LPCWSTR lpFilePath); + bool DownloadToMem(LPCWSTR lpUrl, OUT void** ppBuffer, OUT int* nSize); + void SetDownloadCallback(IHttpCallback* pCallback, void* pParam); + HttpInterfaceError GetErrorCode() { return m_paramsData.errcode; } + void AddHeader(LPCSTR key, LPCSTR value); + int GetResponseCode() { return m_nResponseCode; } + +protected: + bool Init(); + void Release(); + //init + bool InitConnect(LPCWSTR lpUrl, HttpRequestType type, void* lpPostData = NULL, int datelen = 0, LPCWSTR lpHeader = NULL); + bool ConnectHttpServer(LPCWSTR lpIP, WORD wPort); + bool CreateHttpRequest(LPCWSTR lpPage, HttpRequestType type, DWORD dwFlag = 0); + bool SendHttpRequest(void* lpPostData = NULL, int datelen = 0, LPCWSTR lpHeader = NULL); + //query + bool QueryRawHeaders(OUT wstring& strHeaders); + bool QueryContentLength(OUT DWORD& dwLength); + int QueryStatusCode(); + +private: + int m_nResponseCode; + bool m_bHttps; + HINTERNET m_hInternet; + HINTERNET m_hConnect; + HINTERNET m_hRequest; + int m_nConnTimeout; + int m_nSendTimeout; + int m_nRecvTimeout; + CHttpHeader m_header; + HttpParamsData m_paramsData; +}; + diff --git a/UpLoader/HTTP/http_common.h b/UpLoader/HTTP/http_common.h new file mode 100644 index 0000000..d6b444e --- /dev/null +++ b/UpLoader/HTTP/http_common.h @@ -0,0 +1,149 @@ +#pragma once +#include +#include +#include +using std::wstring; +using std::string; +#pragma comment(lib,"WinHttp.lib") + + +inline void MyParseUrlW(LPCWSTR lpUrl, wstring& strHostName, wstring& strPage, WORD& sPort) +{ + sPort = 80; + wstring strTemp(lpUrl); + int nPos = strTemp.find(L"http://"); + if (wstring::npos != nPos) + strTemp = strTemp.substr(nPos + 7, strTemp.size() - nPos - 7); + else + { + nPos = strTemp.find(L"https://"); + if (wstring::npos != nPos) + { + sPort = 443;//INTERNET_DEFAULT_HTTPS_PORT; + strTemp = strTemp.substr(nPos + 8, strTemp.size() - nPos - 8); + } + } + nPos = strTemp.find('/'); + if (wstring::npos == nPos)//ûҵ / + strHostName = strTemp; + else + strHostName = strTemp.substr(0, nPos); + int nPos1 = strHostName.find(':'); + if (nPos1 != wstring::npos) + { + wstring strPort = strTemp.substr(nPos1 + 1, strHostName.size() - nPos1 - 1); + strHostName = strHostName.substr(0, nPos1); + sPort = (WORD)_wtoi(strPort.c_str()); + } + if (wstring::npos == nPos) { + strPage = '/'; + return; + } + strPage = strTemp.substr(nPos, strTemp.size() - nPos); +} + +inline void MyParseUrlA(LPCSTR lpUrl, string& strHostName, string& strPage, WORD& sPort) +{ + sPort = 80; + string strTemp(lpUrl); + int nPos = strTemp.find("http://"); + if (string::npos != nPos) + strTemp = strTemp.substr(nPos + 7, strTemp.size() - nPos - 7); + else + { + nPos = strTemp.find("https://"); + if (wstring::npos != nPos) + { + sPort = 443;//INTERNET_DEFAULT_HTTPS_PORT; + strTemp = strTemp.substr(nPos + 8, strTemp.size() - nPos - 8); + } + } + nPos = strTemp.find('/'); + if (string::npos == nPos)//ûҵ / + strHostName = strTemp; + else + strHostName = strTemp.substr(0, nPos); + int nPos1 = strHostName.find(':'); + if (nPos1 != string::npos) + { + string strPort = strTemp.substr(nPos1 + 1, strHostName.size() - nPos1 - 1); + strHostName = strHostName.substr(0, nPos1); + sPort = (WORD)atoi(strPort.c_str()); + } + if (string::npos == nPos) { + strPage = '/'; + return; + } + strPage = strTemp.substr(nPos, strTemp.size() - nPos); +} + +inline wstring Utf2U(const string& strUtf8) +{ + wstring wstrRet(L""); + int nLen = MultiByteToWideChar(CP_UTF8, 0, strUtf8.c_str(), -1, NULL, 0); + if (nLen == ERROR_NO_UNICODE_TRANSLATION) + throw "Utf8ToUnicodeЧUTF-8ַ"; + wstrRet.resize(nLen + 1, '\0'); + MultiByteToWideChar(CP_UTF8, 0, strUtf8.c_str(), -1, (LPWSTR)wstrRet.c_str(), nLen); + return wstrRet; +} + +inline string U2A(const wstring& str) +{ + string strDes = ""; + if (str.empty()) + return ""; + int nLen = ::WideCharToMultiByte(CP_ACP, 0, str.c_str(), str.size(), NULL, 0, NULL, NULL); + if (0 == nLen) + return ""; + char* pBuffer = new char[nLen + 1]; + memset(pBuffer, 0, nLen + 1); + ::WideCharToMultiByte(CP_ACP, 0, str.c_str(), str.size(), pBuffer, nLen, NULL, NULL); + pBuffer[nLen] = '\0'; + strDes.append(pBuffer); + delete[] pBuffer; + return strDes; +} + +inline wstring A2U(const string& str) +{ + wstring strDes; + if (str.empty()) + return L""; + int nLen = ::MultiByteToWideChar(CP_ACP, 0, str.c_str(), str.size(), NULL, 0); + if (0 == nLen) + return L""; + wchar_t* pBuffer = new wchar_t[nLen + 1]; + memset(pBuffer, 0, nLen + 1); + ::MultiByteToWideChar(CP_ACP, 0, str.c_str(), str.size(), pBuffer, nLen); + pBuffer[nLen] = '\0'; + strDes.append(pBuffer); + delete[] pBuffer; + return strDes; +} + +inline bool FileExistA(LPCSTR lpFile) +{ + HANDLE hFile = CreateFileA(lpFile, GENERIC_READ, FILE_SHARE_READ, NULL, OPEN_EXISTING, FILE_ATTRIBUTE_NORMAL, NULL); + if (hFile == INVALID_HANDLE_VALUE) + return false; + CloseHandle(hFile); + return true; +} + +inline bool FileExistW(LPCWSTR lpFile) +{ + HANDLE hFile = CreateFileW(lpFile, GENERIC_READ, FILE_SHARE_READ, NULL, OPEN_EXISTING, FILE_ATTRIBUTE_NORMAL, NULL); + if (hFile == INVALID_HANDLE_VALUE) + return false; + CloseHandle(hFile); + return true; +} + +inline bool isEmptyString(LPCSTR lpStr) +{ + if (NULL == lpStr || strlen(lpStr) == 0) { + return true; + } + return false; +} \ No newline at end of file diff --git a/UpLoader/HTTP/http_defines.h b/UpLoader/HTTP/http_defines.h new file mode 100644 index 0000000..8e23490 --- /dev/null +++ b/UpLoader/HTTP/http_defines.h @@ -0,0 +1,93 @@ +#pragma once + + +enum HttpRequestType +{ + HttpGet = 0, + HttpPost, +}; +//ö״̬ +enum DownloadState +{ + HttpLoading = 0, + HttpFialed, + HttpFinished, +}; + +/****************************************************** +*Ϣ +* +******************************************************/ +enum HttpInterfaceError +{ + HttpErrorSuccess = 0, //ɹ + HttpErrorInit, //ʼʧ + HttpErrorConnect, //HTTPʧ + HttpErrorSend, //ʧ + HttpErrorQuery, //ѯHTTPͷʧ + HttpError404, //ҳ治 + HttpErrorIllegalUrl, //ЧURL + HttpErrorCreateFile, //ļʧ + HttpErrorDownload, //ʧ + HttpErrorQueryIP, //ȡӦĵַʧ + HttpErrorSocket, //׽ִ + HttpErrorUserCancel, //ûȡ + HttpErrorBuffer, //ļ̫󣬻 + HttpErrorHeader, //HTTPͷ + HttpErrorParam, //󣬿ָ룬ַ + HttpErrorWriteFile, //дļʧ + HttpErrorUnknow, //δ֪ + +}; +//صĻص +class IHttpCallback +{ +public: + virtual void OnDownloadCallback(void* pParam, DownloadState state, double nTotalSize, double nLoadSize) = 0; + virtual bool IsNeedStop() = 0; +}; +//ÿζȡݵĻС 4KB +#define READ_BUFFER_SIZE 4096 + +//ڴõĻС 8M +#define DOWNLOAD_BUFFER_SIZE (8*1024*1024) + +//صϢ +struct HttpParamsData +{ + void* lpparam;//Զ + IHttpCallback* callback;//ص + HttpInterfaceError errcode;// +}; + + +//峣httpͷ +#define HEADER_USER_AGENT "User-Agent" +#define HEADER_CONNECTION "Connection" +#define HEADER_ACCEPT "Accept" +#define HEADER_ACCEPT_ENCODING "Accept-Encoding" +#define HEADER_ACCEPT_LANGUAGE "Accept-Language" +#define HEADER_CONTENT_TYPE "Content-Type" +#define HEADER_HOST "Host" +#define HEADER_RANGE "Range" +#define HEADER_LOCATION "Location" +#define HEADER_CONTENT_LENGTH "Content-Length" + + +//ĬHTTP汾 +static const char default_http_version[] = "HTTP/1.1"; + +//ĬϵuserAgent +static const char default_user_agent[] = "Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/80.0.4044.92 Safari/537.36"; + +//ĬϽ +static const char default_accept[] = "*/*"; + +//Ĭϱ +static const char default_connection[] = "Keep-Alive"; + +//Ĭ +static const char default_language[] = "zh-CN,zh;q=0.9"; + +//HTTPЭ黻з +static const char http_newline[] = "\r\n"; diff --git a/UpLoader/List.h b/UpLoader/List.h new file mode 100644 index 0000000..8f66381 --- /dev/null +++ b/UpLoader/List.h @@ -0,0 +1,235 @@ +#pragma once +#include +#include +using namespace std; +#ifndef PROPERTY +#define PROPERTY(t,n) __declspec( property (put = property__set_##n, get = property__get_##n)) t n +#define READONLY_PROPERTY(t,n) __declspec( property (get = property__get_##n) ) t n +#define WRITEONLY_PROPERTY(t,n) __declspec( property (put = property__set_##n) ) t n +#define GET(t,n) t property__get_##n() +#define SET(t,n) void property__set_##n(const t& value) +#endif // !PROPERTY + + +template> +class List :public vector +{ +public: + List() {} + List(T* val, int len) + { + for (int i = 0; i < len; i++) + { + this->push_back(val[i]); + } + } + List(initializer_list val) + { + for (int i = 0; i < val.size(); i++) + { + this->push_back(val.begin()[i]); + } + } + List(vector< T> val) + { + for (int i = 0; i < val.size(); i++) + { + this->push_back(val[i]); + } + } + ~List() {} + T& operator[](int index) + { + return this->data()[index]; + } + PROPERTY(int, Count); + GET(int, Count) + { + return this->size(); + } + SET(int, Count) + { + this->resize(value); + } + void Add(T val) + { + this->push_back(val); + } + void Clear() + { + this->clear(); + } + void AddRange(T* val, int len) + { + int ldx = this->Count; + this->resize(this->size() + len); + memcpy(&this->operator[](ldx), &val[0], sizeof(T) * len); + } + void AddRange(initializer_list val) + { + int ldx = this->Count; + this->resize(this->size() + val.size()); + memcpy(&this->data()[ldx], &val.begin()[0], sizeof(T) * val.size()); + } + void AddRange(List& val) + { + int ldx = this->Count; + this->resize(this->size() + val.size()); + memcpy(&this->data()[ldx], &val[0], sizeof(T) * val.size()); + } + void AddRange(List* val) + { + int ldx = this->Count; + this->resize(this->size() + val->size()); + memcpy(&this->data()[ldx], &val->data()[0], sizeof(T) * val->size()); + } + void AddRange(vector& val) + { + int ldx = this->Count; + this->resize(this->size() + val.size()); + memcpy(&this->data()[ldx], &val[0], sizeof(T) * val.size()); + } + void AddRange(vector* val) + { + int ldx = this->Count; + this->resize(this->size() + val->size()); + memcpy(&this->data()[ldx], &val->data()[0], sizeof(T) * val->size()); + } + + void Insert(int index, T val) + { + if (index >= this->size()) + { + this->push_back(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val); + } + } + void Insert(int index, initializer_list& val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val.begin(), val.end() - 1); + } + } + void Insert(int index, vector& val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val.begin(), val.end() - 1); + } + } + void Insert(int index, vector* val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val->begin(), val->end() - 1); + } + } + void Insert(int index, List& val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val.begin(), val.end() - 1); + } + } + void Insert(int index, List* val) + { + if (index >= this->size()) + { + this->AddRange(val); + } + else if (index >= 0) + { + this->insert(this->begin() + index, val->begin(), val->end() - 1); + } + } + void RemoveAt(int index) + { + if (index >= 0 && index < this->size()) + { + this->erase(this->begin() + index); + } + } + int IndexOf(T& value) + { + for (int i = 0; i < this->Count; i++) + { + if (this->at(i) == value) + { + return i; + } + } + return -1; + } + bool Contains(T& value) + { + return IndexOf(value) >= 0; + } + int LastIndexOf(T& value) + { + for (int i = this->Count - 1; i >= 0; i--) + { + if (this->at(i) == value) + { + return i; + } + } + return -1; + } + int Remove(T item) + { + int num = 0; + for (int i = this->Count; i >= 0; i--) + { + if (this->data()[i] == item) + { + RemoveAt(i); + num += 1; + } + } + return num; + } + vector& GetVector() + { + return *(vector*)this; + } + T* Pointer() + { + return this->data(); + } + T& get(int i) + { + return this->data()[i]; + } + void set(int i, T val) + { + this->data()[i] = val; + } + T& First() + { + return this->data()[0]; + } + T& Last() + { + return this->data()[this->size() - 1]; + } +}; \ No newline at end of file diff --git a/UpLoader/UpLoader.cpp b/UpLoader/UpLoader.cpp new file mode 100644 index 0000000..b0f5808 --- /dev/null +++ b/UpLoader/UpLoader.cpp @@ -0,0 +1,104 @@ +#include "HTTP/HttpClient.h" +#include "helper.h" +#include +#include "List.h" +char* FindChar(const char* str,char f) +{ + int len = strlen(str); + for (char* c = (char*)str+ len; c >= str; c--) + { + if (*c == f) return c; + } + return nullptr; +} +int main(int argns, char** args) +{ + if (argns > 1) + { + List post_data = List(); + HttpClient* cli = new HttpClient(); + for (int i = 0; i < argns - 1; i++) + { + post_data.clear(); + const char* path = args[i + 1]; + char* fname = FindChar(path, '\\'); + if (fname) + { + try { + fname += 1; + auto data = ReadAllBytes(path); + auto tmp_postdata = ToHex(data->begin(), data->size()); + post_data.Add('\"'); + post_data.AddRange(tmp_postdata, data->size()*2); + post_data.Add('\"'); + wchar_t tmpurl[0x1000] = {0}; + memset(tmpurl, 0, 0x2000); + swprintf_s(tmpurl, L"http://www.sym101.com/Users/FileUpLoad/EFTX\\%ws", Char2TCHAR(fname)); + std::string ret = cli->Post( + tmpurl, + post_data.data(), + post_data.Count, + CONTENTTYPE_JSON); + delete tmp_postdata; + free((void*)data->begin()); + printf_s("[%d/%d] 文件[%s]上传完毕\n", i + 1, argns - 1, fname); + } + catch (exception e) + { + printf_s("[%d/%d] 文件[%s]上传失败->%s\n", i + 1, argns - 1, fname,e.what()); + } + } + } + Sleep(500); + } + return 0; +} + +//int main(int argns, char** args) +//{ +// if (argns > 1) +// { +// const char key[] = "0123456789ABCDEF"; +// for (int i = 0; i < argns - 1; i++) +// { +// const char* path = args[i + 1]; +// char* fname = FindChar(path, '\\'); +// if (fname) +// { +// fname += 1; +// char* fname1 = new char[strlen(fname)]; +// memcpy(fname1, fname, strlen(fname) + 1); +// char* tmp_point = nullptr; +// while(tmp_point=FindChar(fname1, '.')) *tmp_point = '_'; +// +// stringstream str; +// str << "#pragma once\n"; +// str << "unsigned char " << fname1 << " []=\n"; +// str << "{\n"; +// auto data = ReadAllBytes(path); +// char tmp_value[] = {0,0,0}; +// for (int i = 0; i < data->size(); i++) +// { +// unsigned char val= data->begin()[i]; +// tmp_value[0] = key[val / 16]; +// tmp_value[1] = key[val % 16]; +// if (i < data->size() - 1) +// str << "0x" << tmp_value << ","; +// else +// str << "0x" << tmp_value; +// if ((i +1) % 19 == 0 && i != 0) +// { +// str << "\n"; +// } +// } +// str << "};\n"; +// char out_path[2048] = { 0 }; +// *fname = '\0'; +// sprintf_s(out_path,"%s%s.h", path, fname1); +// WriteAllText(out_path, str.str().c_str()); +// } +// } +// Sleep(500); +// } +// return 0; +//} \ No newline at end of file diff --git a/UpLoader/UpLoader.vcxproj b/UpLoader/UpLoader.vcxproj new file mode 100644 index 0000000..a865d23 --- /dev/null +++ b/UpLoader/UpLoader.vcxproj @@ -0,0 +1,147 @@ + + + + + Debug + Win32 + + + Release + Win32 + + + Debug + x64 + + + Release + x64 + + + + 16.0 + Win32Proj + {b9e9ef11-138c-467c-8118-f87ed46f35a5} + UpLoader + 10.0 + + + + Application + true + v143 + Unicode + + + Application + false + v143 + true + Unicode + + + Application + true + v143 + Unicode + + + Application + false + v143 + true + Unicode + + + + + + + + + + + + + + + + + + + + + + Level3 + true + WIN32;_DEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + + + Console + true + + + + + Level3 + true + true + true + WIN32;NDEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + MultiThreaded + + + Console + true + true + true + + + + + Level3 + true + _DEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + + + Console + true + + + + + Level3 + true + true + true + NDEBUG;_CONSOLE;%(PreprocessorDefinitions) + true + MultiThreaded + + + Console + true + true + true + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/UpLoader/UpLoader.vcxproj.filters b/UpLoader/UpLoader.vcxproj.filters new file mode 100644 index 0000000..6bc232d --- /dev/null +++ b/UpLoader/UpLoader.vcxproj.filters @@ -0,0 +1,51 @@ + + + + + {4FC737F1-C7A5-4376-A066-2A32D752A2FF} + cpp;c;cc;cxx;c++;cppm;ixx;def;odl;idl;hpj;bat;asm;asmx + + + {93995380-89BD-4b04-88EB-625FBE52EBFB} + h;hh;hpp;hxx;h++;hm;inl;inc;ipp;xsd + + + {67DA6AB6-F800-4c08-8B7A-83BB121AAD01} + rc;ico;cur;bmp;dlg;rc2;rct;bin;rgs;gif;jpg;jpeg;jpe;resx;tiff;tif;png;wav;mfcribbon-ms + + + {e87857bb-1ee9-4862-ac07-6edbb1e175da} + + + + + 源文件 + + + HTTP + + + HTTP + + + + + HTTP + + + HTTP + + + HTTP + + + HTTP + + + 头文件 + + + 头文件 + + + \ No newline at end of file diff --git a/UpLoader/helper.h b/UpLoader/helper.h new file mode 100644 index 0000000..dc8f6c6 --- /dev/null +++ b/UpLoader/helper.h @@ -0,0 +1,563 @@ +#pragma once +#include +#include +#include +#include +#include +#include +#include +#include +#pragma comment(lib, "urlmon.lib") +#pragma comment(lib, "Wininet.lib") + +using namespace std; +#ifndef typeof +#define typeof(x) decltype(x) +#endif // !typeof + +#ifndef PROPERTY +#define PROPERTY(t,n) __declspec( property (put = property__set_##n, get = property__get_##n)) t n +#define READONLY_PROPERTY(t,n) __declspec( property (get = property__get_##n) ) t n +#define WRITEONLY_PROPERTY(t,n) __declspec( property (put = property__set_##n) ) t n +#define GET(t,n) t property__get_##n() +#define SET(t,n) void property__set_##n(const t& value) +#endif // !PROPERTY + +#ifndef ENCRYPT_SYSTEM_TYPE +#define ENCRYPT_SYSTEM_TYPE(type,name)\ +unsigned long long _##name;\ +PROPERTY(type, name);\ +GET(type, name)\ +{\ + unsigned long long tmpval = _##name ^ ((unsigned long long)&_##name);\ + type result;\ + memcpy(&result, &tmpval, sizeof(result));\ + return result;\ +}\ +SET(type, name)\ +{\ + unsigned long long tmpval = 0;\ + memcpy(&tmpval, &value, sizeof(value));\ + _##name = tmpval ^ ((unsigned long long)&_##name);\ +} +#endif // !ENCRYPT_SYSTEM_TYPE + +#ifndef _IMAGE_DEBUG_DIRECTORY_RAW_ +#define _IMAGE_DEBUG_DIRECTORY_RAW_ +typedef struct _IMAGE_DEBUG_DIRECTORY_RAW { + uint8_t format[4]; + uint8_t PdbSignature[16]; + uint32_t PdbDbiAge; + uint8_t ImageName[256]; + const char* GuidString() + { + char buf[128]; + sprintf_s(buf, "%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X%.2X", + this->PdbSignature[3], this->PdbSignature[2], + this->PdbSignature[1], this->PdbSignature[0], + this->PdbSignature[5], this->PdbSignature[4], + this->PdbSignature[7], this->PdbSignature[6], + this->PdbSignature[8], this->PdbSignature[9], + this->PdbSignature[10], this->PdbSignature[11], + this->PdbSignature[12], this->PdbSignature[13], + this->PdbSignature[14], this->PdbSignature[15] + ); + return buf; + } +} IMAGE_DEBUG_DIRECTORY_RAW, * PIMAGE_DEBUG_DIRECTORY_RAW; +#endif +#pragma region TPattern + +class TPattern +{ + std::string sMask; + std::string sPattern; + std::vector bytes; + bool bIdaStyle = false; + +private: + void Parse() + { + if (bIdaStyle) + { + ParsePatternIDA(); + } + else + { + ParsePattern(); + } + } + void ParsePattern() + { + auto uLen = sMask.length(); + for (uint32_t i = 0; i < uLen; i++) + { + if (i < uLen && sPattern[i] == 0) + { + sPattern[i] = (char)0xFF; + } + if (sMask[i] == '?') + { + bytes.push_back(0); + } + else + { + auto sub = sPattern.substr(i, 1); + auto byte = uint8_t(sub[0]); + bytes.push_back(byte); + } + } + } + + void ParsePatternIDA() + { + auto uLen = sPattern.length(); + sMask.clear(); + int b = 0; + char x, byteBuf = 0; + for (uint32_t i = 0; i < uLen; i++) + { + char c = (char)sPattern[i]; + if (c >= '0' && c <= '9') + { + x = (0x0F & c); + byteBuf += (b) ? x : x << 4; + b++; + } + else if (c >= 'A' && c <= 'F' || c >= 'a' && c <= 'f') + { + if (c > 0x46) + { + c -= 0x20; + } + x = c - 0x37; + byteBuf += (b) ? x : x << 4; + b++; + } + else if (c == '?') + { + if (sPattern[i + 1] == '?') + { + i++; + } + bytes.push_back(0); + sMask += '?'; + } + if (b > 1) + { + bytes.push_back(byteBuf); + b = 0; + byteBuf = 0; + sMask += 'x'; + } + } + } +public: + + TPattern(const char* sPattern) + { + bIdaStyle = true; + this->sPattern = sPattern; + Parse(); + } + + TPattern(const char* sPattern, const char* sMask) + { + this->sMask = sMask; + bytes.resize(this->sMask.length()); + memcpy(&bytes[0], sPattern, bytes.size()); + Parse(); + } + + std::vector Get() + { + return bytes; + } + + std::string GetMask() + { + return sMask; + } + + size_t Size() + { + return bytes.size(); + } +}; +static void* Scan(void* pAddress, size_t size, TPattern* pattern) +{ + auto pat = pattern->Get(); + auto mask = pattern->GetMask(); + uint8_t* pByte = (uint8_t*)pAddress; + size_t j = 0; + for (size_t i = 0; i < size; i++) + { + if (IsBadReadPtr(pByte + i, pat.size())) + { + continue; + } + if (pByte[i] == pat[j] || mask[j] == '?') + { + j++; + if (j == pat.size() - 1) + { + return (void*)((uintptr_t)pByte + i - pat.size() + 2); + } + } + else + { + j = 0; + } + } + return nullptr; +} +static void* ScanPattern(const char* szModule, const char* sPattern) +{ + TPattern* pattern = new TPattern(sPattern); + OutputDebugStringA(pattern->GetMask().c_str()); + MODULEINFO mi{ }; + GetModuleInformation(GetCurrentProcess(), GetModuleHandleA(szModule), &mi, sizeof(mi)); + + LPVOID dwBaseAddress = mi.lpBaseOfDll; + const auto dwModuleSize = mi.SizeOfImage; + return Scan(dwBaseAddress, dwModuleSize - pattern->Size(), pattern); +} +template T FindPattern(const char* szModule, std::string pattern, DWORD_PTR SizeOfImage = NULL) +{ +#define INRANGE(x,a,b) (x >= a && x <= b) +#define getBits( x ) (INRANGE((x&(~0x20)),'A','F') ? ((x&(~0x20)) - 'A' + 0xa) : (INRANGE(x,'0','9') ? x - '0' : 0)) +#define getByte( x ) (getBits(x[0]) << 4 | getBits(x[1])) + HMODULE hModule = GetModuleHandleA(szModule); + const char* pat = pattern.c_str(); + DWORD_PTR firstMatch = 0; + DWORD_PTR rangeStart = (T)hModule; + MODULEINFO miModInfo; + if (!SizeOfImage) + GetModuleInformation(GetCurrentProcess(), hModule, &miModInfo, sizeof(MODULEINFO)); + DWORD_PTR rangeEnd = SizeOfImage ? rangeStart + SizeOfImage : rangeStart + (DWORD_PTR)miModInfo.SizeOfImage; + for (DWORD_PTR pCur = rangeStart; pCur < rangeEnd; pCur++) + { + if (!*pat) + return (T)firstMatch; + + if (*(PBYTE)pat == '\?' || *(BYTE*)pCur == getByte(pat)) + { + if (!firstMatch) + firstMatch = pCur; + + if (!pat[2]) + return (T)firstMatch; + + if (*(PWORD)pat == '\?\?' || *(PBYTE)pat != '\?') + pat += 3; + + else + pat += 2; //one ? + } + else + { + pat = pattern.c_str(); + firstMatch = 0; + } + } + return NULL; +} +#pragma endregion + +static char* TCHAR2char(const wchar_t* STR) +{ + int size = WideCharToMultiByte(CP_ACP, 0, STR, -1, NULL, 0, NULL, FALSE); + char* str = new char[sizeof(char) * size]; + WideCharToMultiByte(CP_ACP, 0, STR, -1, str, size, NULL, FALSE); + return str; + +} +static wchar_t* Char2TCHAR(const char* _char) +{ + int iLength; + iLength = MultiByteToWideChar(CP_ACP, 0, _char, strlen(_char) + 1, NULL, 0); + wchar_t* tchar = new wchar_t[sizeof(wchar_t) * iLength]; + MultiByteToWideChar(CP_ACP, 0, _char, strlen(_char) + 1, tchar, iLength); + return tchar; +} +static string wstring_to_string(wstring s) +{ + return string(TCHAR2char(s.c_str())); +} +static wstring string_to_wstring(string s) +{ + return wstring(Char2TCHAR(s.c_str())); +} +static char* ToHex(const char* data, size_t len) +{ + const char* key = "0123456789ABCDEF"; + char* result = new char[(len * 2) + 1]; + result[(len * 2)] = '\0'; + for (int i = 0; i < len; i++) + { + result[i * 2] = key[((unsigned char)data[i]) / 0x10]; + result[(i * 2) + 1] = key[((unsigned char)data[i]) % 0x10]; + } + return result; +} +static char* ToHex(const BYTE* data, size_t len) +{ + const char* key = "0123456789ABCDEF"; + char* result = new char[(len * 2) + 1]; + for (int i = 0; i < len; i++) + { + result[i * 2] = key[((unsigned char)data[i]) / 0x10]; + result[(i * 2) + 1] = key[((unsigned char)data[i]) % 0x10]; + } + result[len * 2] = '\0'; + return result; +} +static vector ParseHex(const char* hex) +{ + vector result = vector(); + int len = strlen(hex); + BYTE* buffer = new BYTE[len]; + bool ish = true; + BYTE val = 0; + for (int i = 0; i < len; i++) + { + bool isval = false; + BYTE v = 0; + if (hex[i] >= '0' && hex[i] <= '9') + { + v = (hex[i] - '0'); + isval = true; + } + else if (hex[i] >= 'A' && hex[i] <= 'F') + { + v = 10 + (hex[i] - 'A'); + isval = true; + } + else if (hex[i] >= 'a' && hex[i] <= 'f') + { + v = 10 + (hex[i] - 'a'); + isval = true; + } + if (isval) + { + if (ish) + { + val = (v << 4) | val; + } + else + { + val = v | val; + result.push_back(val); + val = 0; + } + ish = !ish; + } + } + return result; +} +static initializer_list* ReadAllBytes(const char* filePath) +{ + HANDLE pFile; + DWORD fileSize; + char* buffer, * tmpBuf; + DWORD dwBytesRead, dwBytesToRead, tmpLen; + + pFile = CreateFileA(filePath, + GENERIC_READ, + FILE_SHARE_READ, + NULL, + OPEN_EXISTING, + FILE_ATTRIBUTE_NORMAL, + NULL); + if (pFile == INVALID_HANDLE_VALUE) + { + CloseHandle(pFile); + return nullptr; + } + fileSize = GetFileSize(pFile, NULL); + buffer = (char*)malloc(fileSize); + if (!buffer) + { + return nullptr; + } + ZeroMemory(buffer, fileSize); + dwBytesToRead = fileSize; + dwBytesRead = 0; + tmpBuf = buffer; + do { + if (!ReadFile(pFile, tmpBuf, dwBytesToRead, &dwBytesRead, NULL) || dwBytesRead == 0) + break; + dwBytesToRead -= dwBytesRead; + tmpBuf += dwBytesRead; + + } while (dwBytesToRead > 0); + CloseHandle(pFile); + return new initializer_list(&buffer[0], &buffer[fileSize]); +} +static BOOL WriteAllBytes(const char* filePath, char* buffer, int len) +{ + HANDLE pFile; + char* tmpBuf; + DWORD dwBytesWrite, dwBytesToWrite; + + pFile = CreateFileA(filePath, + GENERIC_WRITE, + 0, + NULL, + CREATE_ALWAYS, + FILE_ATTRIBUTE_NORMAL, + NULL); + + if (pFile == INVALID_HANDLE_VALUE) + { + CloseHandle(pFile); + return FALSE; + } + + dwBytesToWrite = len; + dwBytesWrite = 0; + + tmpBuf = buffer; + + do { + + WriteFile(pFile, tmpBuf, dwBytesToWrite, &dwBytesWrite, NULL); + + dwBytesToWrite -= dwBytesWrite; + tmpBuf += dwBytesWrite; + + } while (dwBytesToWrite > 0); + + CloseHandle(pFile); + + return TRUE; +} +static BOOL WriteAllBytes(const char* filePath, BYTE* buffer, int len) +{ + return WriteAllBytes(filePath, (char*)buffer, len); +} +static BOOL WriteAllBytes(const char* filePath, vector buffer) +{ + return WriteAllBytes(filePath, (char*)buffer.data(), buffer.size()); +} +static BOOL WriteAllBytes(const char* filePath, initializer_list buffer) +{ + return WriteAllBytes(filePath, (char*)buffer.begin(), buffer.size()); +} +static BOOL WriteAllBytes(const char* filePath, initializer_list buffer) +{ + return WriteAllBytes(filePath, (char*)buffer.begin(), buffer.size()); +} +static BOOL WriteAllText(const char* filePath, const char* text) +{ + return WriteAllBytes(filePath, (char*)text, strlen(text)); +} +static vector HttpRequest(const char* url) +{ +#define MAXSIZE 4096 + vector result = vector(); + BYTE* val = new BYTE[MAXSIZE]; + ULONG len = 1; + HINTERNET hSession = InternetOpenA(NULL, INTERNET_OPEN_TYPE_PRECONFIG, NULL, NULL, 0); + if (hSession != NULL) + { + HINTERNET hHttp = InternetOpenUrlA(hSession, url, NULL, 0, INTERNET_FLAG_DONT_CACHE, 0); + + if (hHttp != NULL) + { + while (len > 0) + { + InternetReadFile(hHttp, val, MAXSIZE - 1, &len); + if (len > 0) + { + int ldx = result.size(); + result.resize(result.size() + len); + memcpy(&result.operator[](ldx), &val[0], len); + } + } + InternetCloseHandle(hHttp); + hHttp = NULL; + } + InternetCloseHandle(hSession); + hSession = NULL; + } + return result; +} + +static string WebRequest(const char* url) +{ +#define BLOCK_READ 4096 + IStream* stream; + HRESULT result = URLOpenBlockingStreamA(0, url, &stream, 0, 0); + if (result != 0) + { + return ""; + } + char buffer[BLOCK_READ]; + unsigned long bytesRead; + stringstream ss; + stream->Read(buffer, BLOCK_READ, &bytesRead); + while (bytesRead > 0U) + { + ss.write(buffer, (long long)bytesRead); + stream->Read(buffer, BLOCK_READ, &bytesRead); + } + stream->Release(); + return ss.str(); +} + + +static BYTE* _get_jmp_address(BYTE* ptr) +{ + if (*ptr == 0xE9) + { + return (ptr + 5) + (*(UINT32*)&ptr[1]); + } + return ptr; +} +static int _get_index(BYTE* ptr) +{ + if (*(UINT16*)ptr == 0x20FF) + { + return 0; + } + if (*(UINT16*)ptr == 0x60FF) + { + return ptr[2] / sizeof(void*); + } + if (*(UINT16*)ptr == 0xA0FF) + { + return *(UINT32*)&ptr[2] / sizeof(void*); + } + return -1; +} +template +static int GetVTableIndex(T funcaddr) +{ + void* proc = (void*&)funcaddr; + BYTE* addr = _get_jmp_address((BYTE*)proc); + for (int i = 0; i < 32; i++) + { + if (addr[i] == 0xFF) + { + auto dx = _get_index(&addr[i]); + if (dx >= 0) return dx; + } + } + return -1; +} +static POINT GetMousePos(HWND Hwnd) +{ + POINT p; + GetCursorPos(&p); + ScreenToClient(Hwnd, &p); + return p; +} +static bool InRect(POINT point, POINT LOC, SIZE SIZ) +{ + int xf = point.x - LOC.x; + int yf = point.y - LOC.y; + return xf >= 0 && xf <= SIZ.cx && + yf >= 0 && yf <= SIZ.cy; +} +